Recombinant Escherichia coli Biopolymer transport protein exbB (exbB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
exbB; b3006; JW2974; Biopolymer transport protein ExbB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
exbB
Target Protein Sequence
MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQ LLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVA AVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLA TAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQK LRAG
Uniprot No.

Target Background

Function
ExbB is involved in TonB-dependent, energy-transducing transport of various receptor-bound substrates. It protects ExbD from proteolytic degradation and functionally stabilizes TonB.
Gene References Into Functions
  1. The ExbB-ExbD-TonB complex forms in a 4:1:1 molar ratio. PMID: 25802296
  2. 10-residue deletion scanning mutagenesis revealed that the cytoplasmic loop of ExbB (residues 40-129) is crucial for TonB system activity. PMID: 23913327
  3. Data analysis indicates that ExbB transmembrane domain residues are not directly involved in proton pathways. PMID: 23603742
  4. ExbB6 and ExbB6ExbD1 represent subcomplexes upon which the final complex, including TonB, assembles. PMID: 21905676
Database Links
Protein Families
ExbB/TolQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of ExbB protein in E. coli?

ExbB is a membrane-bound protein with three transmembrane helices that is primarily located in the cytoplasmic membrane (CM) of Gram-negative bacteria. With a molecular weight of 26.3 kDa, ExbB has more residues facing the cytoplasm than exposed to the periplasm. The protein is encoded in the same operon as ExbD, reflecting their linked functionality. ExbB serves as a structural scaffold, forming oligomeric structures including dimers and tetramers that are essential for the proper assembly and function of the TonB-dependent transport system .

How does ExbB function within the TonB complex system?

ExbB functions as part of the TonB energy transduction system, which includes ExbB, ExbD, and TonB proteins. This complex harnesses the proton motive force (PMF) of the cytoplasmic membrane to energize transport processes at the outer membrane. ExbB plays a critical "scaffolding" role in this system, stabilizing both ExbD and TonB while facilitating the assembly of the complex into its functional configuration. Although ExbB doesn't directly participate in proton translocation across the cytoplasmic membrane, it appears to propagate signals between the cytoplasm and periplasm, enabling the energy coupling that powers iron acquisition across the outer membrane .

What is the stoichiometry of the ExbB-ExbD-TonB complex?

Research has demonstrated that the functional ExbB-ExbD-TonB complex exists in a 4:1:1 stoichiometry (ExbB₄-ExbD₁-TonB₁). This was determined through rigorous biochemical analyses of copurified proteins. This ratio differs from the cellular abundance ratio, which may reflect the presence of both complete three-protein complexes and incomplete ExbB-ExbD complexes in vivo. The tetrameric arrangement of ExbB molecules forms the core of this complex, creating a scaffold that facilitates the proper positioning and function of ExbD and TonB components .

What expression systems are most effective for producing recombinant ExbB protein?

E. coli remains the most effective and widely used expression system for recombinant ExbB protein production due to its fast growth kinetics, well-established genetic tools, and compatibility with membrane protein expression. The following table compares different expression systems for recombinant ExbB:

Expression SystemAdvantagesLimitationsYieldRecommended Applications
E. coliFast growth, economical, extensive genetic tools, high yieldsLimited post-translational modifications, potential inclusion body formationHighStructural studies, biochemical assays
YeastSome post-translational modifications, proper protein foldingSlower growth than E. coli, more complex media requirementsModerateFunctional studies requiring eukaryotic modifications
BaculovirusAdvanced folding machinery, suitable for complex proteinsTime-consuming, technically demanding, expensiveModerateStudies requiring native-like protein conformation
Mammalian cellsFull range of post-translational modificationsSlow growth, expensive, low yieldsLowStudies requiring mammalian-specific modifications

For most academic research applications, the E. coli expression system provides the optimal balance of yield, cost, and ease of use for recombinant ExbB production .

What plasmid design considerations are important for optimal ExbB expression?

When designing expression plasmids for recombinant ExbB, several key factors must be considered:

Successful expression strategies have included the use of pET-based vectors with His₆-tagged ExbB-ExbD and S-tagged TonB, allowing for efficient purification of the complete complex .

How can inclusion body formation be minimized when expressing recombinant ExbB?

As a membrane protein, ExbB is prone to inclusion body formation during recombinant expression. Several strategies can minimize this issue:

  • Reduce expression rate: Lower induction temperatures (16-25°C), decreased inducer concentrations, and weaker promoters can slow protein synthesis, allowing proper membrane insertion.

  • Co-expression with chaperones: Molecular chaperones like GroEL/GroES can assist in proper protein folding.

  • Optimize growth media: Supplementation with glycerol (0.5-1%) can enhance membrane protein expression.

  • Use specialized E. coli strains: C41(DE3) and C43(DE3) strains are engineered for membrane protein expression.

  • Fusion partners: Solubility-enhancing tags like MBP (maltose-binding protein) can improve proper folding.

  • Expression as part of the complete complex: Co-expression with ExbD and TonB can enhance proper folding and membrane integration, as these proteins naturally interact and stabilize each other.

Implementation of these strategies can significantly improve the yield of properly folded, membrane-integrated ExbB protein suitable for functional and structural studies .

What purification strategies yield the highest quality ExbB protein preparations?

Purifying membrane proteins like ExbB requires specialized approaches. The following methodology has proven effective:

  • Membrane isolation: After cell lysis, differential centrifugation separates the membrane fraction containing ExbB.

  • Detergent solubilization: Non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or Triton X-100 effectively solubilize ExbB while preserving its native conformation.

  • Affinity chromatography: For His₆-tagged constructs, Ni⁺-NTA affinity chromatography under native conditions (20 mM Tris pH 8.0, 150 mM NaCl, 0.1% detergent) yields good purity.

  • Ion exchange chromatography: SP-Sepharose cation exchange can provide further purification.

  • Size exclusion chromatography: A final polishing step resolves different oligomeric states and removes aggregates.

  • Amphipol exchange: Replacing detergents with amphipols can stabilize the protein for certain applications.

When purifying the complete ExbB-ExbD-TonB complex, it's critical to maintain gentle conditions throughout to preserve complex integrity. Purified complexes with stoichiometry ExbB₄-ExbD₁-TonB₁ have been successfully isolated using these approaches .

How can researchers assess the functional integrity of purified ExbB protein?

Multiple complementary approaches can verify that purified ExbB retains its native structure and function:

  • Size exclusion chromatography: Confirms proper oligomeric state (tetrameric arrangement for ExbB).

  • Circular dichroism (CD) spectroscopy: Verifies secondary structure content, particularly important for confirming proper folding of transmembrane helices.

  • Reconstitution into liposomes: Demonstrates membrane integration capability.

  • Complex formation analysis: Ability to form stable complexes with ExbD and TonB indicates functional integrity.

  • Electron microscopy: Negative staining and single-particle EM can reveal structural features consistent with native conformation.

  • PMF-responsiveness assays: In reconstituted systems, functional ExbB should respond to proton gradients in concert with ExbD and TonB.

These assays collectively provide a comprehensive assessment of ExbB functionality, with proper tetrameric assembly and the ability to form stable complexes with partner proteins being key indicators of successful purification .

What biophysical techniques are most informative for studying ExbB structure and interactions?

Several biophysical approaches have provided valuable insights into ExbB structure and function:

  • Single-particle electron microscopy (EM): Has revealed different conformational states of the ExbB₄-ExbD₁-TonB₁ complex, showing variable ExbD-TonB heterodimerization that likely represents different functional states.

  • Nuclear magnetic resonance (NMR): While challenging for full-length ExbB, NMR has been used to study specific domains and interactions.

  • Cross-linking coupled with mass spectrometry: Identifies interaction interfaces between ExbB and its binding partners.

  • Isothermal titration calorimetry (ITC): Quantifies binding affinities between ExbB and partner proteins.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps flexible regions and conformational changes upon complex formation.

  • Förster resonance energy transfer (FRET): Monitors conformational changes in real-time when fluorescent labels are strategically placed.

Single-particle EM has been particularly informative, enabling the reconstruction of the ExbB₄-ExbD₁-TonB₁ complex in three distinct conformational states that suggest a model for TonB-mediated iron acquisition .

How do mutations in ExbB affect the assembly and function of the TonB energy transduction system?

Systematic mutational analysis has revealed several regions of ExbB critical for proper function:

  • Transmembrane domains: Mutations in the first transmembrane domain disrupt interactions with TonB's N-terminus, highlighting this region's importance in complex assembly.

  • Cytoplasmic domains: Alterations in cytoplasmic regions affect signal propagation between the cytoplasm and periplasm, demonstrating ExbB's role beyond simple scaffolding.

  • Oligomerization interfaces: Mutations at dimerization and tetramerization interfaces disrupt higher-order assembly, preventing formation of the functional complex.

  • ExbD interaction sites: Specific residues mediate ExbB-ExbD interactions; their mutation destabilizes the complex and abolishes energy transduction.

Studies using site-directed mutagenesis followed by functional assays have shown that while ExbB doesn't directly participate in proton translocation, it plays essential roles in complex assembly, protein stabilization, and signal propagation. The tetrameric arrangement of ExbB appears particularly important, as mutations disrupting this quaternary structure severely compromise TonB-dependent processes .

What conformational changes occur in the ExbB-ExbD-TonB complex during energy transduction?

Electron microscopy studies have captured the ExbB₄-ExbD₁-TonB₁ complex in multiple conformational states that appear to represent different stages of the energy transduction cycle:

  • Resting state: ExbD and TonB are relatively distant from each other within the complex.

  • Energized state: PMF activation causes ExbD's Asp25 residue to respond, promoting ExbD-TonB heterodimerization.

  • Force-generating state: Conformational changes in ExbB's cytoplasmic domains are transmitted to the periplasmic regions, generating mechanical force.

These structural transitions correspond to functional stages in which the complex harnesses the proton motive force to generate mechanical energy that enables TonB to interact with and energize outer membrane transporters. The variable ExbD-TonB heterodimerization observed in these states suggests a dynamic mechanism for force generation and transmission across the periplasmic space .

How does the ExbB-ExbD-TonB system compare with other bacterial energy transduction systems?

The ExbB-ExbD-TonB system represents a unique energy transduction mechanism with both similarities and differences compared to other bacterial systems:

Energy Transduction SystemCellular LocationEnergy SourceMechanismBiological Function
ExbB-ExbD-TonBCytoplasmic membrane to outer membraneProton motive forceMechanical force generationIron-siderophore uptake
TolQ-TolR-TolACytoplasmic membrane to outer membraneProton motive forceConformational changesCell envelope integrity
Flagellar motorCytoplasmic membraneProton motive forceRotational torqueMotility
ATP-binding cassette transportersCytoplasmic membraneATP hydrolysisConformational changesDiverse substrate transport
Phosphotransferase systemCytoplasmic membranePhosphoenolpyruvatePhosphoryl transferSugar uptake and phosphorylation

The ExbB-ExbD-TonB system is unique in that it transduces energy across the periplasmic space to power transport at a distant membrane. This trans-envelope energy coupling mechanism represents a fascinating solution to the challenge of powering outer membrane transport processes from the energized inner membrane .

What are the key considerations when designing experiments to study ExbB-ExbD-TonB interactions?

When investigating interactions within the ExbB-ExbD-TonB complex, researchers should consider:

  • Protein expression strategies:

    • Co-expression of all three proteins often yields better results than reconstituting the complex from individually expressed components

    • Maintaining proper stoichiometry is critical; use of dual-expression vectors with controlled promoter strengths can help achieve this

  • Membrane environment preservation:

    • Detergent selection significantly impacts complex integrity; mild non-ionic detergents or amphipols are preferred

    • Native lipid preservation or reconstitution into liposomes may be necessary for certain functional studies

  • Interaction detection methods:

    • In vivo crosslinking captures transient interactions

    • Co-immunoprecipitation confirms stable complex formation

    • FRET or BRET approaches can detect dynamic interactions in real-time

  • Controls and validation:

    • Include non-interacting protein controls

    • Verify that fusion tags don't artificially promote or inhibit interactions

    • Use multiple complementary methods to confirm interactions

  • Functional correlation:

    • Connect observed interactions to functional outcomes through iron transport assays

    • Consider the effects of environmental factors (pH, ion concentrations) that influence PMF and thus complex function

These methodological considerations ensure that experimental results accurately reflect the physiologically relevant interactions within this complex system .

How can researchers reconcile contradictory data in ExbB research?

Contradictions in ExbB research literature can arise from several sources. Here are methodological approaches to address these discrepancies:

  • Expression system variations:

    • Different expression levels may alter complex stoichiometry

    • Compare native expression versus overexpression data carefully

    • Solution: Use native promoters or carefully calibrated inducible systems

  • Detergent and buffer effects:

    • Detergent choice significantly impacts membrane protein behavior

    • Different pH and salt conditions alter protein-protein interactions

    • Solution: Test multiple conditions and extrapolate to physiological relevance

  • Isolation methods impact:

    • Harsh purification procedures may disrupt native complexes

    • Solution: Compare results from different isolation techniques and prefer milder approaches

  • In vitro versus in vivo discrepancies:

    • The NMR structure of isolated ExbD periplasmic fragment obtained under non-physiological conditions (pH 3, low salt) appears inconsistent with in vivo crosslinking data

    • Solution: Prioritize results obtained under more physiological conditions

  • Stoichiometry variations:

    • Published cellular ratios (ExbB:ExbD:TonB = 7:2:1) differ from purified complex ratios (4:1:1)

    • Solution: Consider that cellular ratios may represent a mixture of complete and incomplete complexes

When evaluating contradictory data, researchers should carefully consider the experimental context and methodological differences, weighing evidence based on physiological relevance and experimental rigor .

What novel technologies are emerging for studying the ExbB-ExbD-TonB system?

Recent technological advances have opened new avenues for investigating this complex:

  • Cryo-electron microscopy: Enables high-resolution structural analysis of membrane protein complexes in near-native environments without crystallization.

  • Single-molecule techniques:

    • Optical tweezers can directly measure the force generated during TonB energization

    • Single-molecule FRET can track conformational changes in real-time

  • Native mass spectrometry: Allows determination of complex stoichiometry and dynamics while preserving non-covalent interactions.

  • In-cell NMR: Provides structural information in the living cellular environment.

  • Nanodiscs and SMALPs: Novel membrane mimetics that better preserve native lipid environments than traditional detergent micelles.

  • Computational approaches:

    • Molecular dynamics simulations predict conformational changes during energy transduction

    • Machine learning algorithms help interpret complex datasets from multiple experimental approaches

  • CRISPR-based approaches: Enable precise genomic modifications to study ExbB function in its native context without overexpression artifacts.

These emerging technologies promise to resolve long-standing questions about the mechanisms of ExbB function and energy transduction across the bacterial cell envelope, potentially leading to new antimicrobial strategies targeting this essential system .

How might targeting the ExbB-ExbD-TonB system lead to novel antimicrobial strategies?

The ExbB-ExbD-TonB system presents an attractive target for antimicrobial development for several reasons:

  • Essential function: Iron acquisition is critical for bacterial pathogenicity and survival during infection.

  • Uniqueness to bacteria: This system has no human homolog, potentially reducing side effects.

  • Surface accessibility: Components of the system extend to the bacterial surface, making them more accessible to drugs.

  • Structural knowledge: Increasing structural understanding enables structure-based drug design.

Potential therapeutic approaches include:

  • Small molecule inhibitors: Compounds that disrupt ExbB oligomerization or prevent ExbB-ExbD-TonB interactions.

  • Peptide mimetics: Peptides that mimic interaction interfaces and competitively inhibit complex formation.

  • Energy coupling disruptors: Molecules that prevent PMF-mediated conformational changes.

  • Combination strategies: ExbB-ExbD-TonB inhibitors could sensitize bacteria to conventional antibiotics by limiting iron acquisition.

As bacterial iron acquisition is vital for pathogenicity, blocking this system holds significant promise for therapeutic development, particularly against multidrug-resistant Gram-negative pathogens .

What are the current limitations in ExbB research and how can they be addressed?

Despite significant progress, several challenges remain in ExbB research:

  • Lack of high-resolution structures:

    • Challenge: While EM structures exist, atomic-resolution structures of the complete ExbB-ExbD-TonB complex remain elusive

    • Solution: Apply advanced cryo-EM techniques combined with computational modeling

  • Limited functional assays:

    • Challenge: Direct measurement of energy transduction is difficult

    • Solution: Develop real-time assays for monitoring conformational changes and force generation

  • Physiological context:

    • Challenge: Most studies use overexpression systems that may not reflect native conditions

    • Solution: CRISPR-based approaches to tag endogenous proteins without overexpression

  • Dynamic process understanding:

    • Challenge: The energy transduction mechanism involves transient states difficult to capture

    • Solution: Single-molecule approaches to observe individual complexes in action

  • Therapeutic development barriers:

    • Challenge: Translating structural insights into effective inhibitors

    • Solution: Fragment-based drug discovery and high-throughput screening approaches

Addressing these limitations requires interdisciplinary collaboration between structural biologists, biochemists, microbiologists, and medicinal chemists to fully elucidate the ExbB-ExbD-TonB energy transduction mechanism and exploit it for therapeutic purposes .

How does understanding ExbB function contribute to broader knowledge in bacterial physiology and evolution?

The study of ExbB provides insights into several fundamental aspects of bacterial biology:

  • Energy transduction mechanisms: The ExbB-ExbD-TonB system represents a unique solution to the challenge of powering outer membrane processes using inner membrane energy, illuminating the diversity of energy coupling mechanisms in biology.

  • Bacterial adaptation to iron limitation: This system evolved as a sophisticated response to the universal challenge of iron acquisition, demonstrating how bacteria adapt to nutritional constraints.

  • Membrane protein complex assembly: ExbB's role in complex formation illustrates principles of membrane protein oligomerization and complex assembly applicable to many biological systems.

  • Trans-envelope signaling: The mechanism by which conformational changes propagate across the periplasmic space reveals principles of long-range communication in cellular systems.

  • Molecular evolution: Comparative analysis of ExbB across bacterial species illuminates evolutionary patterns in essential cellular machinery.

  • Host-pathogen interactions: Understanding how pathogens acquire iron during infection through this system provides insights into the molecular basis of virulence.

The ExbB-ExbD-TonB system thus serves as a model for studying fundamental biological principles with implications extending far beyond its specific function in bacterial iron acquisition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.