Recombinant Escherichia coli Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Introduction

Escherichia coli cardiolipin synthase (Cls) is an enzyme that catalyzes the synthesis of cardiolipin (CL), an anionic phospholipid crucial for various cellular processes in bacteria . The enzyme facilitates the reversible transfer of a phosphatidyl group from one phosphatidylglycerol molecule to another, resulting in the formation of cardiolipin and glycerol . The cls gene, which encodes for CL synthase, is located at minute 28.02 on the E. coli genetic map .

Physiological Significance

  1. Cellular Functions: Cardiolipin is essential for the proper functioning of respiratory enzymes, such as cytochrome c oxidase, and plays a significant role in bacterial adaptation and survival .

  2. Impact on Growth and Viability: Mutations in the cls gene can lead to longer doubling times and reduced viability during the stationary phase. cls mutants exhibit altered sensitivity to certain compounds like 3,4-dihydroxybutyl-1-phosphonate and novobiocin .

  3. Biofilm Formation: Cardiolipin influences biofilm formation in E. coli. Depletion of cardiolipin can reduce biofilm formation by up to 50% . The absence of cardiolipin activates the Rcs envelope stress response, which represses flagella production, disrupts initial biofilm attachment, and reduces biofilm growth .

Regulation and Activity

  1. Regulation: CL synthase activity is regulated at both genetic and enzymatic levels .

  2. Inhibition: The enzyme is inhibited by cardiolipin, the product of the reaction, and by phosphatidate. Phosphatidylethanolamine can partially offset the inhibition caused by cardiolipin but not by phosphatidate .

  3. Activation: Specific conditions, such as the presence of 400 mM phosphate and 0.015% Triton X-100, can markedly activate the enzyme .

Molecular Properties

  1. Molecular Mass: The molecular mass of CL synthase is approximately 45-46 kDa, which is slightly less than the size predicted by the gene sequence, suggesting post-translational processing . Maxicell analysis also indicates that the cls gene product has a molecular weight of 46,000 .

  2. Conserved Regions: Comparison of amino acid sequences from different bacterial CL synthases reveals three highly conserved regions, including the pentapeptide sequence RN(Q)HRK and the sequence HXK, which may be part of the active site .

Genetic and Molecular Studies

  1. Cloning and Amplification: The cls gene has been cloned and amplified using recombinant plasmids, leading to a significant increase in cardiolipin synthase activity in transformed cells .

  2. Complementation Studies: Hybrid plasmids containing the cls gene can restore cardiolipin synthesis in cls mutants, confirming the gene's function .

Role in Protein Translocation

  1. Protein Translocation: Cardiolipin enhances protein translocation across the inner membrane. Depletion of cardiolipin negatively affects Sec-mediated protein translocation in vivo .

  2. RcsF Interaction: Cardiolipin depletion impairs translocation of proteins across the inner membrane, activating the Rcs pathway through the outer membrane lipoprotein RcsF .

Impact on Membrane and Cell Physiology

  1. Membrane Potential: Amplification of cardiolipin synthase can lead to a decrease in membrane potential and increased fragility of spheroplasts .

  2. Stress Response: Depletion of phosphatidylethanolamine (PE) or phosphatidylglycerol (PG) causes severe physiological defects and activates multiple stress responses, whereas depletion of cardiolipin has less quantifiable effect on cell physiology .

Purification and Assay

  1. Purification Methods: CL synthase can be purified to homogeneity using extraction with Triton X-114 and chromatography on DEAE-cellulose . A simple purification method involves extraction of crude membrane fractions with Triton X-100 and phosphocellulose column chromatography .

  2. Assay Procedures: A specific and sensitive assay procedure measures the radioactivity of glycerol formed from phosphatidyl[2-3H]glycerol .

Table 1: Effects of Phosphoglycerides on Cardiolipin Synthase Activity

CompoundEffect
CardiolipinInhibits cardiolipin synthase
PhosphatidateInhibits cardiolipin synthase
PhosphatidylinositolNo inhibition
Bis-phosphatidateNo inhibition
PhosphatidylethanolaminePartially offsets inhibition by cardiolipin, but not by phosphatidate
Magnesium chlorideHas the opposite effect of phosphatidylethanolamine

Table 2: Impact of cls Gene on Growth and Cardiolipin Synthesis

FeatureEffect
cls mutationSmall decrease in growth rate
cls pss-I double mutationCauses severe defect and increased temperature sensitivity in growth; not remediable with a single supplement of sucrose or $$MgCl_2$$ to a broth medium.
Hybrid PlasmidsRestore cardiolipin-synthesizing ability to the wild-type level both in vivo and in vitro, in addition to the capability of growth on NBY-S200 at 42°C.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
clsA; cls; UTI89_C1447; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Escherichia coli (strain UTI89 / UPEC)
Target Names
clsA
Target Protein Sequence
MTTVYTLVSWLAILGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLAVGE LHLGKRRAERARAMWPSTAKWLNDLKACKHIFAEENSSVAAPLFKLCERRQGIAGVKGNQ LQLMTESDDVMQALIRDIQLARHNIEMVFYIWQPGGMADQVAESLMAAARRGIHCRLMLD SAGSVAFFRSPWPELMRNAGIEVVEALKVNLMRVFLRRMDLRQHRKMIMIDNYIAYTGSM NMVDPRYFKQDAGVGQWIDLMARMEGPIATAMGIIYSCDWEIETGKRILPPPPDVNIMPF EQASGHTIHTIASGPGFPEDLIHQALLTAAYSAREYLIMTTPYFVPSDDLLHAICTAAQR GVDVSIILPRKNDSMLVGWASRAFFTELLAAGVKIYQFEGGLLHTKSVLVDGELSLVGTV NLDMRSLWLNFEITLAIDDKGFGADLAAVQDDYISRSRLLDARLWLKRPLWQRVAERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, forming cardiolipin (CL, diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cardiolipin synthase in Escherichia coli and what is its role?

Cardiolipin synthase in Escherichia coli is an enzyme encoded by the cls gene responsible for synthesizing cardiolipin, a major membrane phospholipid. The enzyme catalyzes the conversion of two phosphatidylglycerol molecules to form cardiolipin and glycerol. The mechanism can be represented by the following reaction:

2 Phosphatidylglycerol → cardiolipin + glycerol

This enzyme plays a crucial role in membrane phospholipid metabolism and contributes to the proper structure and function of bacterial membranes. While not absolutely essential for survival, the presence of cardiolipin synthase confers growth and survival advantages to E. coli cells as demonstrated by studies with cls gene disruption .

What is the molecular structure of E. coli cardiolipin synthase?

The E. coli cls open reading frame (ORF) predicts a 54.8 kDa polypeptide, though the mature cardiolipin synthase protein is actually 46 kDa. This difference suggests post-translational processing of the enzyme. The N-terminal region extending to residue 60 contains several conserved residues but is interestingly not essential for enzyme activity, as deletion mutants missing residues 2-60 produce fully active proteins .

The enzyme contains specific conserved residues in its N-terminal region that appear to play roles in protein processing and topology rather than direct catalytic activity. For example, conserved residues Leu-7 and Val-8 are particularly important, as their replacement with serine residues results in an enzyme that retains in vitro activity but loses most of its in vivo activity .

How does cardiolipin deficiency affect E. coli cellular functions?

Cardiolipin deficiency in E. coli has several significant impacts on cellular function:

  • Reduced growth rates and final culture densities compared to wild-type strains

  • Impaired protein translocation across the inner membrane

  • Activation of the Rcs envelope stress response

  • Reduction in biofilm formation by up to 50%

  • Impaired flagellar assembly, affecting bacterial motility

  • Disruption of initial biofilm attachment and subsequent biofilm development

These effects demonstrate that while cardiolipin is not absolutely essential, it plays important roles in membrane function, stress response, and multicellular behaviors. The connection between cardiolipin levels and the Rcs signaling pathway reveals a molecular link between membrane phospholipid composition and complex bacterial behaviors like biofilm formation .

What are the methods for creating recombinant E. coli cardiolipin synthase?

To create recombinant E. coli cardiolipin synthase, researchers typically employ the following methodology:

  • Gene Cloning: The cls gene is amplified from E. coli genomic DNA using PCR with specific primers designed to include appropriate restriction sites.

  • Vector Selection: The gene is cloned into expression vectors like pBR322 derivatives or other suitable plasmids with strong, inducible promoters.

  • Transformation: The recombinant plasmid is transformed into an appropriate E. coli strain, often a strain with the chromosomal cls gene disrupted to avoid interference from native enzyme.

  • Expression Induction: Protein expression is induced using appropriate inducers (e.g., IPTG for lac promoter systems).

  • Epitope Tagging: For easier purification and detection, epitope tags can be incorporated. For example, EYMPE epitope (EE) tags have been successfully introduced into the interior of cardiolipin synthase without compromising enzymatic activity .

  • Protein Purification: The recombinant enzyme can be purified using affinity chromatography if tagged, or through conventional purification techniques.

For functional studies, researchers have successfully created various modified versions including deletion mutants (lacking residues 2-60) and site-directed mutants with altered conserved residues, demonstrating the flexibility of recombinant approaches for studying this enzyme .

How can cardiolipin synthase activity be measured in laboratory settings?

Cardiolipin synthase activity can be measured through several complementary approaches:

  • Radioactive Substrate Assay: This traditional approach involves:

    • Incubating the enzyme with radioactively labeled substrates (e.g., phosphatidyl[2-³H]glycerol)

    • Allowing the reaction to proceed (2 Phosphatidylglycerol → cardiolipin + glycerol)

    • Separating reaction products by thin-layer or column chromatography

    • Quantifying radioactivity in the cardiolipin fraction

    • Calculating enzyme activity based on substrate conversion rates

  • Glycerol Release Measurement: Since the reaction produces free glycerol, researchers can:

    • Phosphorylate released glycerol with ATP using glycerol kinase (EC 2.7.1.30)

    • Isolate labeled sn-3-glycero-3-phosphate chromatographically

    • Quantify to determine reaction progress

  • Isotope Ratio Analysis: When using dual-labeled substrates (e.g., [³²P]phosphatidyl[2-³H]glycerol), the ratio of isotopes in the product can confirm the reaction mechanism. For cardiolipin synthase, the tritium:³²P ratio in the cardiolipin product is half that of the starting phosphatidylglycerol, consistent with the elimination of one mole of glycerol during conversion .

  • In vivo Activity Assessment: Analyzing phospholipid composition of cellular membranes through techniques like:

    • Lipid extraction from cells

    • Thin-layer chromatography separation

    • Phosphate content analysis of lipid fractions

    • Comparison of cardiolipin levels between wild-type and mutant strains

What experimental approaches can be used to study cls gene disruption effects?

Studying the effects of cls gene disruption involves several methodological approaches:

  • Gene Disruption Techniques:

    • Insertion of antibiotic resistance genes (e.g., kanamycin-resistant gene) into the cls gene

    • Complete replacement of the cls gene with marker genes

    • Exchange of the disrupted gene with the chromosomal copy through homologous recombination

  • Confirmation of Disruption:

    • Southern blot hybridization to verify proper genomic alterations

    • Transductional linkage analysis to confirm genetic modifications

    • PCR verification of gene disruption

  • Phenotypic Analysis:

    • Growth rate measurement in various media conditions

    • Final culture density determination

    • Comparison with wild-type strains and classical cls-1 mutation strains

  • Complementation Studies:

    • Introduction of plasmids carrying intact cls gene into disruptants

    • Evaluation of growth restoration and membrane phospholipid composition

    • This approach confirms that observed phenotypes are directly attributable to cls disruption

  • Enzyme Activity Assessment:

    • Measurement of cardiolipin synthase activity in cell extracts

    • Analysis of residual cardiolipin formation through alternative pathways

These methodologies have revealed that while cls gene disruption eliminates detectable cardiolipin synthase activity, E. coli strains can still grow, albeit with reduced growth rates and final culture densities compared to wild-type strains .

How do N-terminal conserved residues affect cardiolipin synthase function?

The N-terminal region of E. coli cardiolipin synthase presents an interesting research puzzle. Studies show that while the N-terminal region extending to residue 60 contains several conserved residues, it is not essential for enzyme activity, as deletion mutants missing residues 2-60 produce fully active proteins. This raises the question of why several residues in a non-essential region are evolutionarily conserved .

Research using site-directed mutagenesis has revealed that conserved residues in the N-terminal region, particularly Leu-7 and Val-8, play significant roles in protein processing and topology rather than direct catalytic activity. When these residues are replaced with serine residues, the resulting enzyme displays:

  • Retention of in vitro enzymatic activity

  • Significant loss of in vivo activity

  • Higher apparent molecular mass than the parent protein

These findings suggest that the conserved N-terminal residues influence post-translational processing, membrane insertion, or protein folding that affects in vivo functionality. The difference between the predicted 54.8 kDa polypeptide and the 46 kDa mature enzyme further supports the role of processing in cardiolipin synthase maturation .

To investigate this phenomenon, researchers have successfully employed epitope tagging approaches, introducing EYMPE epitope (EE) tags into the interior of cardiolipin synthase without compromising enzymatic activity. This technique enables tracking of protein processing and localization to better understand the specific roles of these conserved N-terminal residues .

What are the mechanisms behind low-level cardiolipin synthesis in cls mutants?

An intriguing finding from cls disruption studies is that low but definite levels of cardiolipin are synthesized even in cls gene disruptants where cardiolipin synthase activity is not detectable. This suggests alternative pathways for cardiolipin synthesis in E. coli. Several mechanisms have been proposed:

  • Phosphatidylserine Synthase Involvement: Research suggests that phosphatidylserine synthase (encoded by the pss gene) may contribute to minor cardiolipin formation. This is supported by observations that:

    • Cardiolipin content of cls mutants depends on the dosage of the pss gene

    • Attempts to transfer a null allele of the cls gene into a pss-1 mutant were unsuccessful

    • This indicates a potential synthetic lethality and suggests essential cooperation between these pathways

  • Alternative Enzymatic Activities: Other enzymes in the phospholipid biosynthesis pathway may possess secondary activities that can produce cardiolipin at low levels, particularly under stress conditions.

  • Non-enzymatic Formation: Under certain conditions, chemical or physical processes might facilitate limited non-enzymatic formation of cardiolipin-like structures.

These findings point to the possibility that cardiolipin is essential for E. coli survival, with the cell developing multiple redundant mechanisms to ensure at least minimal levels are maintained. The exact molecular mechanisms behind these alternative pathways remain an active area of research .

What is the relationship between cardiolipin deficiency, protein translocation, and the Rcs signaling pathway?

Research has uncovered a complex relationship between cardiolipin levels, protein translocation, and stress response signaling in E. coli:

  • Protein Translocation Defects: Cardiolipin depletion impairs the translocation of proteins across the inner membrane. This is likely due to cardiolipin's role in maintaining proper membrane properties and potentially direct interactions with protein translocation machinery .

  • Rcs Pathway Activation: The reduced protein translocation efficiency activates the Regulation of Colanic Acid Synthesis (Rcs) envelope stress response pathway. This activation is hypothesized to occur through the outer membrane lipoprotein RcsF, which serves as a sensor for envelope stress .

  • Downstream Effects: Once activated, the Rcs pathway:

    • Represses the production of flagella

    • Disrupts initial biofilm attachment

    • Reduces biofilm growth by as much as 50%

    • Alters expression of numerous genes related to envelope stress response

This signaling cascade reveals a molecular connection between membrane phospholipid composition and complex bacterial behaviors like biofilm formation. The research suggests a model where:

Cardiolipin depletion → Protein translocation defects → RcsF sensing/signaling → Rcs pathway activation → Altered gene expression → Reduced flagella/biofilm formation

This mechanistic understanding provides insight into how bacterial cells sense and respond to changes in membrane composition, linking basic lipid biochemistry to complex multicellular behaviors relevant to bacterial adaptation and survival .

How can recombinant cardiolipin synthase be used to study membrane phospholipid dynamics?

Recombinant cardiolipin synthase offers several powerful approaches for studying membrane phospholipid dynamics:

  • Controlled Expression Systems: Using inducible promoters to modulate cls expression allows researchers to:

    • Create systems with varying levels of cardiolipin

    • Study membrane adaptation to changing phospholipid composition

    • Observe real-time membrane remodeling during stress responses

  • Tagged Enzyme Studies: Epitope-tagged versions of the enzyme (such as with the EYMPE epitope) enable:

    • Tracking enzyme localization within bacterial membranes

    • Monitoring protein-protein interactions

    • Studying the temporal aspects of cardiolipin synthesis during cell cycle progression

  • Structure-Function Analysis: Site-directed mutagenesis of recombinant cls allows:

    • Investigation of catalytic mechanisms

    • Understanding how specific residues influence activity

    • Exploring the dual roles of conserved regions in both processing and function

  • Reconstitution Experiments: Purified recombinant enzyme can be used for:

    • Incorporation into artificial membrane systems

    • Studying the effects of different lipid environments on enzyme activity

    • Investigating cardiolipin domain formation and membrane organization

These approaches have revealed insights into how cardiolipin contributes to membrane properties, protein translocation, and bacterial stress responses, providing a foundation for understanding the complex interplay between membrane composition and cellular physiology .

What experimental design considerations are important when studying cardiolipin synthase mutants?

When designing experiments to study cardiolipin synthase mutants, researchers should consider several critical factors:

  • Genetic Background Selection:

    • Choose appropriate E. coli strains based on experimental goals

    • Consider potential synthetic lethal interactions (e.g., with pss mutations)

    • Use isogenic strains for valid comparisons between wild-type and mutants

  • Mutation Strategy:

    • Determine whether complete gene disruption or specific mutations are appropriate

    • Consider both insertion mutations and deletion/replacement approaches

    • For studying specific residues, employ site-directed mutagenesis targeting conserved regions

  • Verification Methods:

    • Confirm genetic modifications using multiple techniques (Southern blot, PCR, transductional linkage)

    • Verify protein expression levels through Western blotting

    • Assess enzyme activity using appropriate biochemical assays

  • Complementation Controls:

    • Include plasmid-based complementation to confirm phenotypes are due to cls disruption

    • Use both constitutive and inducible promoters to control expression levels

    • Consider the effects of protein overexpression artifacts

  • Growth Condition Variables:

    • Test multiple growth media compositions

    • Examine responses to various stressors (osmotic, temperature, pH)

    • Monitor growth through different phases (lag, exponential, stationary)

    • Consider long-term survival in stationary phase

  • Analysis of Complex Phenotypes:

    • For biofilm studies, employ multiple quantification methods

    • When studying stress responses, monitor multiple pathway components

    • Consider both direct effects of cardiolipin absence and indirect effects through stress pathway activation

These considerations help ensure robust experimental designs that can distinguish between direct enzymatic effects and broader physiological consequences of cardiolipin deficiency.

How does cardiolipin synthase research inform bacterial adaptation and survival strategies?

Research on cardiolipin synthase provides significant insights into bacterial adaptation and survival strategies:

  • Membrane Homeostasis and Stress Response:

    • Cardiolipin levels change in response to environmental stresses

    • The enzyme's activity helps bacteria adapt membrane composition to changing conditions

    • Cardiolipin-enriched domains at cell poles and division sites suggest roles in cell division and chromosome segregation

  • Biofilm Formation Mechanisms:

    • Cardiolipin depletion reduces biofilm formation by as much as 50%

    • This occurs through Rcs pathway activation and subsequent repression of flagella production

    • Understanding this connection provides potential targets for modulating biofilm formation in clinical and industrial settings

  • Protein Translocation and Envelope Integrity:

    • Cardiolipin supports efficient protein translocation across membranes

    • Proper translocation is essential for envelope integrity and function

    • This connection reveals how lipid composition influences protein trafficking and cell envelope maintenance

  • Metabolic Adaptation:

    • The enzyme's non-essentiality but contribution to optimal growth demonstrates metabolic flexibility

    • Alternative pathways for minimal cardiolipin synthesis highlight redundant systems for essential functions

    • This redundancy represents an evolutionary strategy for maintaining fitness despite genetic perturbations

  • Signaling Integration:

    • The link between cardiolipin levels, protein translocation, and Rcs pathway activation demonstrates how bacteria integrate multiple cellular processes

    • This integration allows coordinated responses to membrane perturbations

    • Understanding these signaling networks provides insights into bacterial decision-making and adaptation

This research suggests that modulating membrane phospholipid composition could be a viable approach for altering bacterial behaviors related to adaptation, survival, and virulence, with potential applications in combating bacterial infections and biofilm-related problems .

What are the common difficulties in purifying active recombinant cardiolipin synthase?

Purifying active recombinant cardiolipin synthase presents several technical challenges. Based on research experience, these challenges and their solutions include:

  • Membrane Protein Solubilization:

    • Challenge: As a membrane protein, cardiolipin synthase is hydrophobic and difficult to solubilize without denaturing.

    • Solution: Use gentle detergents like n-dodecyl-β-D-maltoside or digitonin; optimize detergent concentration to maintain activity while achieving solubilization.

  • Maintaining Enzyme Activity:

    • Challenge: The enzyme often loses activity during purification procedures.

    • Solution: Include cardiolipin or phosphatidylglycerol in buffers to stabilize the enzyme; minimize time between cell disruption and activity assays; perform purification at 4°C.

  • Expression Systems:

    • Challenge: Overexpression can lead to inclusion body formation or toxicity.

    • Solution: Use temperature-inducible or tightly regulated expression systems; consider using E. coli strains with disrupted chromosomal cls to avoid native enzyme interference .

  • Post-translational Processing:

    • Challenge: The difference between the predicted 54.8 kDa polypeptide and the 46 kDa mature enzyme suggests processing that may be difficult to reproduce in recombinant systems .

    • Solution: Express the enzyme with its native N-terminal sequence intact; consider co-expression with processing enzymes if identified.

  • Activity Assessment:

    • Challenge: Distinguishing between in vitro and in vivo activity, as seen with L7V8 mutations that retain in vitro activity but lose in vivo function .

    • Solution: Develop complementary assay systems; compare purified enzyme activity with functional complementation in cls-deficient strains.

Incorporating epitope tags such as the EYMPE epitope (EE) tag into the interior of the enzyme rather than at termini has proven successful in maintaining biological properties while facilitating purification and detection .

How can researchers overcome challenges in analyzing the effects of cardiolipin deficiency?

Analyzing the effects of cardiolipin deficiency presents unique challenges that require specialized methodological approaches:

  • Distinguishing Direct vs. Indirect Effects:

    • Challenge: Separating primary effects of cardiolipin absence from secondary effects due to stress response activation.

    • Solution: Use time-course studies after cardiolipin depletion; employ conditional mutants; analyze multiple phenotypes simultaneously; compare with other membrane perturbations .

  • Compensatory Mechanisms:

    • Challenge: Low-level cardiolipin synthesis through alternative pathways can mask effects of cls disruption .

    • Solution: Create multiple mutation strains (e.g., cls and pss); use lipidomics to comprehensively profile all phospholipids; employ pulse-chase experiments to track lipid turnover.

  • Growth Phenotype Subtlety:

    • Challenge: cls mutants show only modest growth defects under standard conditions .

    • Solution: Test growth under various stress conditions (osmotic, pH, temperature); examine long-term survival; analyze competitive fitness in mixed cultures.

  • Complex Phenotype Analysis:

    • Challenge: Phenotypes like biofilm formation involve multiple cellular processes .

    • Solution: Break down analysis into discrete steps (e.g., surface attachment, microcolony formation, maturation); use microscopy to visualize structural differences; employ genetic reporters to monitor gene expression changes.

  • Signaling Pathway Dissection:

    • Challenge: Understanding how cardiolipin depletion activates the Rcs pathway .

    • Solution: Use epistasis analysis with multiple pathway components; employ phosphorylation-specific antibodies to track signaling; create reporter constructions for real-time monitoring of pathway activation.

These approaches help researchers develop a more comprehensive understanding of how cardiolipin contributes to bacterial physiology and adaptation, moving beyond simple growth phenotypes to understand complex cellular responses to membrane perturbations .

What are the recommended controls for validating recombinant cardiolipin synthase experiments?

Proper experimental controls are critical for validating research on recombinant cardiolipin synthase. Based on the available literature, recommended controls include:

  • Genetic Validation Controls:

    • Wild-type strain with native cls gene (positive control)

    • cls-1 classical mutation strain (partial function control)

    • Complete cls gene disruption strain (negative control)

    • Complementation with plasmid-borne cls gene (restoration control)

  • Protein Expression Controls:

    • Western blot analysis to confirm expression levels of recombinant enzyme

    • Size comparison between predicted (54.8 kDa) and mature (46 kDa) forms to verify processing

    • Expression of epitope-tagged versions to track protein localization and processing

  • Enzymatic Activity Controls:

    • In vitro assays with known quantities of purified enzyme

    • Kinetic analysis with varying substrate concentrations

    • Activity measurements at different temperatures and pH values

    • Inclusion of known inhibitors to confirm specificity

  • Phenotypic Validation Controls:

    • Lipid composition analysis comparing wild-type, mutant, and complemented strains

    • Growth curve analysis under multiple conditions

    • Biofilm formation assays with appropriate positive and negative controls

    • Protein translocation efficiency measurements

  • Mechanistic Investigation Controls:

    • Site-directed mutagenesis of catalytic residues

    • Domain swapping experiments to verify functional regions

    • Truncation mutants to identify essential portions of the enzyme

    • Double mutants to investigate genetic interactions (e.g., cls with pss)

  • Technical Controls for Assays:

    • No-enzyme controls in activity assays

    • Heat-inactivated enzyme controls

    • Substrate-only controls

    • Standard curves for quantification

These comprehensive controls ensure that experimental results related to recombinant cardiolipin synthase are robust, reproducible, and accurately reflect the biological roles and properties of this important enzyme .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.