Recombinant Escherichia coli Coupling protein TraD (traD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
traD; ECOK12F102; Coupling protein TraD; DNA transport protein TraD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-717
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
traD
Target Protein Sequence
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWIKISWQTFVNGCIY WWCTTLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCSEQLWSAFVLAAVVAL VICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPII RDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRSGEFVKSYYDPSIDKILNP LDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQGSGRTIFAEAAYLMRNDPNRS YSKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIEKTAISIRAVLTNYVKAIRYLQGIEHN GEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAASLFDVMNTRA FFRSPSHKIAEFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSL PDLTCYVTLPGPYPAVKLSLKYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMA SLFEPDVPEVVSGEDVTQAEQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQ QLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF
Uniprot No.

Target Background

Function
Conjugative DNA transfer (CDT) is the unidirectional transfer of single-stranded DNA plasmids from a donor to a recipient cell. This process is the primary mechanism by which antibiotic resistance and virulence factors spread within bacterial populations. TraD couples the transferosome to a type IV secretion system, likely forming a pore for single-stranded plasmid DNA transfer to the secretion system. The C-terminal 37 residues are crucial for plasmid specificity and transfer efficiency, with additional specificity provided by the TraD-TraM interaction.
Protein Families
TrwB coupling protein family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is TraD and what is its role in bacterial conjugation?

TraD is a coupling protein (CP) that plays an essential role in bacterial conjugation systems, particularly in type IV secretion systems found in various pathogens. TraD serves as a critical connector between the DNA-processing machinery (relaxosome) and the mating pair-forming (Mpf) transfer apparatus . This connection is fundamental for successful conjugative DNA transfer between bacterial cells. As demonstrated in multiple studies, TraD is required for the transmission of genetic material during bacterial conjugation, highlighting its importance in horizontal gene transfer mechanisms .

What are the key structural domains of TraD protein?

TraD protein consists of several important structural domains that contribute to its function:

  • N-terminal domain: Contains transmembrane regions that anchor the protein in the cytoplasmic membrane

  • Central cytoplasmic domain: Contributes to interactions with relaxosomal components

  • C-terminal domain: The final 38 amino acids are crucial for interaction with TraM (relaxosomal protein)

Research has shown that the C-terminal domain is particularly significant for TraD function. When 38 amino acids were removed from the C terminus of TraD, no binding to TraM was observed, indicating this region contains the main TraM interaction domain . Additionally, a truncated version of TraD termed TraD11 (ΔN155) demonstrated strong interaction with TraM, with an apparent association constant of 2.6 × 10^7 liters/mol .

How does TraD function in type IV secretion systems?

In type IV secretion systems (T4SS), TraD functions as a coupling protein that connects the relaxosome (DNA processing complex) to the secretion apparatus. This connection is essential for substrate selection and transfer during bacterial conjugation. The specific mechanisms include:

  • Substrate recognition: TraD interacts with relaxosomal components like TraM to recognize the correct DNA for transfer

  • Energy provision: As an ATPase, TraD likely provides energy required for the transfer process

  • Signal transduction: TraD transmits signals between the relaxosome and the transfer apparatus

What techniques are used to study TraD-TraM interactions?

Several experimental techniques have been successfully employed to study TraD-TraM interactions:

Table 1: Experimental Techniques for Studying TraD-TraM Interactions

TechniqueDescriptionKey FindingsReference
Overlay assaysTraD variants separated by SDS-PAGE and transferred to nitrocellulose, then overlaid with purified TraMStrong binding observed between TraD11 and TraM; no binding with C-terminal truncated TraD21
Enzyme-linked immunosorbent assays (ELISA)TraD11 or TraD21 bound to plate wells, incubated with increasing concentrations of MBP-TraMApparent association constant for TraD11-MBP-TraM determined to be 2.6 × 10^7 liters/mol
Electrophoretic mobility shift assaysTraD variants incubated with TraM complexed with target DNATraD11 strongly binds to TraM even when TraM is in complex with DNA
Co-immunoprecipitation (coIP)Radiolabeling and precipitation of proteins using specific antibodiesUsed to study TraD oligomerization in vivo

These techniques provide complementary information about the interaction between TraD and TraM, demonstrating both the specificity and strength of this interaction. The combination of in vitro and in vivo approaches has been crucial for understanding the functional significance of these interactions in bacterial conjugation .

How can recombinant TraD be expressed and purified for structural studies?

Expression and purification of recombinant TraD for structural studies involves several key steps:

  • Vector Construction:

    • Subcloning of traD alleles into expression vectors like pTrc99A or lower-copy-number vectors like pEG100

    • Incorporation of tags (such as calmodulin-binding protein (CBP) or i31) to facilitate purification and detection

  • Host Selection:

    • E. coli strains like BT8-derived strains have been successfully used for TraD expression

    • For difficult-to-express recombinant proteins, specialized host strains may be required

  • Expression Optimization:

    • Temperature, induction conditions, and media composition need optimization

    • Addition of fusion tags (His, FLAG, MBP) can improve solubility and expression

  • Purification Strategy:

    • Affinity chromatography using the fusion tag (CBP-TraD can be purified using calmodulin affinity)

    • Size exclusion chromatography to isolate properly folded protein

    • Ion exchange chromatography for additional purification if needed

  • Protein Quality Assessment:

    • SDS-PAGE and Western blotting using anti-TraD antibodies to confirm identity

    • Functional assays to verify activity of the purified protein

For structural studies, it's important to note that certain regions of TraD may be more amenable to expression and crystallization. For example, researchers have successfully expressed and studied truncated versions like TraD11 (ΔN155) that retain functional domains while being more stable and easier to purify than the full-length protein .

What are the methods to study TraD oligomerization in vivo?

The oligomerization of TraD in vivo has been studied using several methodological approaches:

  • Co-immunoprecipitation (coIP):

    • Expression of wild-type TraD from plasmids like pBT200 or pEG103

    • Expression of mutant variants from pEG100-derived or pNLK5-derived plasmids

    • Radiolabeling and precipitation using specific antibodies (polyclonal i31 antiserum or polyclonal anti-TraD antibody)

    • Immune complexes precipitation using IgGsorb (Enzyme Center)

  • Pulse-chase experiments:

    • A 5-minute pulse followed by a 15- or 20-minute chase to study oligomerization dynamics

    • Helps distinguish between stable and transient interactions

  • Mutational analysis:

    • Creation of mutant libraries using λTn lacZ/in mutagenesis

    • Generation of i31-tagged insertions to disrupt protein folding at specific locations

    • Assessment of oligomerization capacity of mutant proteins compared to wild-type

  • Cross-linking studies:

    • Chemical cross-linking to stabilize oligomeric complexes

    • Analysis by SDS-PAGE and immunoblotting

These approaches have provided valuable insights into TraD oligomerization, which is likely important for its function in bacterial conjugation systems.

How do mutations in TraD affect conjugative DNA transfer?

Mutations in TraD can significantly impact conjugative DNA transfer, as demonstrated through various experimental approaches:

Table 2: Impact of TraD Mutations on Conjugative DNA Transfer

Mutation TypeRegion AffectedEffect on ConjugationMechanismReference
i31 insertionsVarious positionsMost insertions severely defectiveDisruption of protein folding/function
TraDiQ76N-terminal region50% of wild-type functionPartial disruption
C-terminal truncation (38 aa)C-terminusSeverely defectiveLoss of TraM binding
TraD15 overexpression-Dominant negative effectSequestration of TraM

Most i31 insertion mutations in TraD result in severe conjugation defects, with the exception of TraDiQ76, which retained approximately 50% of wild-type conjugation frequency . This suggests that most regions of TraD are important for its function in conjugation.

The C-terminal domain is particularly critical, as demonstrated by experiments with TraD15 (the 38 C-terminal amino acids of TraD). When overexpressed, TraD15 exerted a dominant negative effect on DNA transfer but not on phage infection by pilus-specific phage R17. This indicates that the TraM-TraD interaction is important specifically for conjugative DNA transfer rather than for phage infection .

What is the relationship between TraD and the relaxosome?

The relationship between TraD and the relaxosome is central to bacterial conjugation:

  • Physical interaction: TraD physically interacts with relaxosomal protein TraM through its C-terminal domain. This interaction has been demonstrated through multiple experimental approaches including overlay assays, ELISA, and electrophoretic mobility shift assays .

  • Functional coupling: TraD couples the relaxosome (DNA processing complex) to the mating pair formation (Mpf) system, enabling the transfer of processed DNA through the secretion apparatus.

  • Substrate selection: The TraD-TraM interaction appears to be involved in substrate selection, with evidence suggesting that "substrate selection within the IncF plasmid group is based on TraM's capability to select the correct DNA molecule for transport and not on substrate selection by the CP [coupling protein]" .

  • Species specificity: Interestingly, TraD encoded by the closely related F factor can bind to TraM encoded by the R1 plasmid, suggesting some cross-compatibility between related systems .

The TraD-relaxosome relationship is essential for proper DNA processing and transfer during conjugation. When this relationship is disrupted, as in experiments where the C-terminal 38 amino acids of TraD were expressed separately (TraD15), conjugative transfer is inhibited because TraD15 acts as a molecular decoy that sequesters TraM molecules .

How does TraD function differ between phage infection and conjugative DNA transfer?

Research has revealed important distinctions in TraD function between phage infection and conjugative DNA transfer:

These findings highlight the dual functionality of TraD in bacterial systems, with distinct roles in horizontal gene transfer and phage infection processes.

What are the current challenges in studying TraD function in vivo?

Several significant challenges complicate the study of TraD function in vivo:

  • Protein topology and membrane integration:

    • TraD is a membrane-associated protein with both transmembrane and cytoplasmic domains

    • Studying the native conformation while maintaining protein function is technically challenging

  • Complex formation and dynamics:

    • TraD interacts with multiple components of the conjugation machinery

    • Capturing the dynamic nature of these interactions requires sophisticated approaches

  • Functional redundancy:

    • Some functions may be partially compensated by other proteins

    • Distinguishing primary from secondary effects of TraD mutations can be difficult

  • Technical limitations:

    • Real-time visualization of TraD during conjugation remains challenging

    • Many studies rely on indirect measurements of TraD function

  • Expression level control:

    • Overexpression can lead to artifacts

    • Achieving physiologically relevant expression levels while maintaining detectability is difficult

Future research directions might include the development of more sophisticated imaging techniques, the use of new protein tagging strategies that minimally disturb function, and systems biology approaches to better understand the complex network of interactions involved in bacterial conjugation.

How do different expression systems affect recombinant TraD production?

Different expression systems significantly impact recombinant TraD production, affecting yield, solubility, and functionality:

Improving the solubility of recombinant TraD, which contains transmembrane domains and may tend to aggregate, requires specialized strategies:

  • Fusion tags:

    • Solubility-enhancing tags like MBP (maltose-binding protein), SUMO, TRX, and His tags

    • These tags have been shown to enhance protein solubility and aid in affinity purification

    • For TraD specifically, calmodulin-binding protein (CBP) fusion tags have been used successfully

  • Expression temperature manipulation:

    • Lowering the temperature after induction often leads to more soluble protein

    • Slower protein synthesis allows more time for proper folding

  • Domain-based approaches:

    • Expressing specific soluble domains rather than full-length protein

    • TraD11 (ΔN155), which lacks N-terminal transmembrane domains, has been successfully expressed and studied

    • The C-terminal fragment TraD15 (amino acids 698-735) also expresses well

  • Co-expression strategies:

    • Co-expression with molecular chaperones can improve folding

    • Chemical chaperones in the media can prevent inclusion body formation

  • Detergent solubilization:

    • For membrane proteins like TraD, mild detergents can maintain native structure

    • KK buffer containing 0.01% dodecyl maltoside has been used in TraD studies

  • Codon optimization:

    • Adjusting codons to match the preferences of the expression host

    • This can improve translation efficiency and reduce the likelihood of misfolding

Research has shown that truncated versions of TraD, particularly those retaining the functional cytoplasmic domain while removing transmembrane regions, tend to express better and remain more soluble than full-length protein .

How does TraD from different bacterial species compare functionally?

Comparative analysis of TraD from different bacterial species reveals important similarities and differences:

  • Cross-compatibility:

    • TraD encoded by the F factor can bind to TraM encoded by the R1 plasmid

    • This suggests structural conservation of interaction domains across related systems

  • Functional specificity:

    • Despite cross-recognition, there are likely specific adaptations in different TraD proteins

    • These adaptations may relate to host range and conjugation efficiency

  • Structural conservation:

    • The C-terminal domain is particularly conserved, reflecting its importance in TraM interaction

    • Transmembrane topology shows similarities across different TraD proteins

  • Related coupling proteins:

    • TraD belongs to a family of coupling proteins found in type IV secretion systems

    • Comparisons with other coupling proteins like VirD4 from Agrobacterium can provide insights into shared mechanisms

Future research could focus on more detailed comparative studies to identify key conserved and variable regions that might explain differences in host specificity and conjugation efficiency between different TraD variants.

What are the potential applications of TraD research in biotechnology?

TraD research has several potential applications in biotechnology:

  • Enhanced DNA delivery systems:

    • Understanding TraD function could lead to improved bacterial transformation methods

    • Engineered conjugation systems might provide alternatives to traditional transformation techniques

  • Antibacterial drug development:

    • TraD is essential for conjugative transfer of antibiotic resistance genes

    • Inhibitors of TraD-TraM interaction could potentially reduce the spread of antibiotic resistance

  • Protein production platforms:

    • Insights from TraD expression studies contribute to the broader field of recombinant protein production

    • Strategies for membrane protein expression are valuable for many biotechnological applications

  • Synthetic biology tools:

    • Engineered TraD variants could serve as components in synthetic genetic circuits

    • Controlled DNA transfer systems might be valuable in various synthetic biology applications

  • Vaccine development:

    • Understanding bacterial secretion systems has implications for the development of recombinant vaccine technologies

    • TraD research contributes to our knowledge of how bacteria transfer macromolecules

Future directions in this field may include structure-based design of TraD inhibitors, engineering of TraD for enhanced DNA transfer capabilities, and integration of TraD into synthetic biological systems.

What expression vectors are recommended for recombinant TraD production?

For recombinant TraD production, several expression vectors have been successfully used:

  • pTrc99A: A high-copy-number vector with an IPTG-inducible promoter, useful for high-level expression

  • pEG100: A lower-copy-number vector that may provide more physiological expression levels

  • pNLK5-derived plasmids: Used for mutagenesis and functional studies of TraD

The choice depends on your research goals. For structural studies requiring high protein yields, pTrc99A may be preferred. For functional studies where proper folding and physiological expression levels are critical, pEG100 might be more suitable. Consider incorporating appropriate fusion tags to facilitate purification and detection.

How can I assess the functionality of recombinant TraD variants?

To assess functionality of recombinant TraD variants, several complementary approaches can be used:

  • Conjugation assays:

    • Express the TraD variant in a traD-deletion strain (e.g., F′ΔD)

    • Measure conjugation frequency by counting transconjugants per donor cell

    • Compare to wild-type TraD expression

  • Protein-protein interaction assays:

    • Overlay assays, ELISA, or co-immunoprecipitation to assess TraM binding

    • Quantify binding affinity and compare to wild-type TraD

  • Phage infection assays:

    • Test sensitivity to pilus-specific phages like R17

    • This assesses whether the TraD variant affects pilus assembly or function

  • Localization studies:

    • Immunofluorescence microscopy to determine proper localization

    • Membrane fractionation to confirm association with appropriate cellular compartments

A comprehensive assessment would include multiple approaches to evaluate different aspects of TraD functionality.

What are the best conditions for solubilizing and purifying membrane-associated TraD protein?

For solubilizing and purifying membrane-associated TraD protein:

  • Detergent selection:

    • Mild non-ionic detergents like dodecyl maltoside (0.01%) preserve structure

    • Detergent screening may be necessary to optimize solubilization conditions

  • Buffer composition:

    • KK buffer (50 mM Tris-Cl [pH 8.0], 1 mM EDTA, 150 mM NaCl) with detergent

    • Include protease inhibitors to prevent degradation

  • Domain-based approaches:

    • Consider expressing soluble domains (e.g., TraD11, which lacks N-terminal transmembrane regions)

    • The cytoplasmic domain is often easier to purify than full-length protein

  • Affinity purification:

    • Use fusion tags like CBP, His, or MBP for affinity chromatography

    • Multiple purification steps may be needed for high purity

  • Quality assessment:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Functional assays to verify activity of purified protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.