Recombinant Escherichia coli Cytochrome b561 (cybB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
cybB; b1418; JW5224; Cytochrome b561; Cytochrome b-561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
Target Protein Sequence
MENKYSRLQISIHWLVFLLVIAAYCAMEFRGFFPRSDRPLINMIHVSCGISILVLMVVRL LLRLKYPTPPIIPKPKPMMTGLAHLGHLVIYLLFIALPVIGLVMMYNRGNPWFAFGLTMP YASEANFERVDSLKSWHETLANLGYFVIGLHAAAALAHHYFWKDNTLLRMMPRKRS
Uniprot No.

Target Background

Function
B-type di-heme cytochrome with a major alpha-absorption peak at 561 nm and a minor peak at 555 nm.
Database Links
Protein Families
Cytochrome b561 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is cytochrome b561 (cybB) in Escherichia coli and how does it differ from eukaryotic homologs?

Cytochrome b561 in E. coli (cybB) is a transmembrane electron transport protein containing b-type hemes. Unlike the eukaryotic cytochrome b561 proteins that function primarily in ascorbate recycling and iron metabolism, the E. coli cybB gene encodes a structurally similar but functionally distinct protein. The eukaryotic cytochrome b561 family is unique to eukaryotes, exhibits high conservation across species, and typically consists of 200-300 amino acids with approximately half embedded within the membrane bilayer . While eukaryotic cytochrome b561 forms a homodimer with six transmembrane helices and two heme groups per protomer , the E. coli cybB has been identified as a structural gene for cytochrome b561 located on the chromosome .

The distinct characteristic of both prokaryotic and eukaryotic forms is their ability to transfer electrons across membranes, though their physiological electron donors and acceptors may differ. The prokaryotic expression system allows researchers to study the fundamental properties of this protein while offering advantages in terms of yield and manipulation.

How is the cybB gene structured and localized in E. coli K12?

The cybB gene, encoding cytochrome b561, is located on the chromosome of Escherichia coli K12. Through cloning experiments, it has been established that the gene is contained within a 1.3 kb DNA fragment . Initial studies involved cloning a 37 kb fragment of DNA from an F-prime factor (F100-12) that showed a gene dosage effect on b-type cytochromes using a cosmid vector (pHC79) . Further analyses using gel filtration of cytochromes and product analysis of hybrid plasmids confirmed this fragment contained the structural gene for cytochrome b561.

The gene was subsequently subcloned into the pBR322 vector after isolating a chromosomal DNA fragment carrying the cybB gene using plaque hybridization techniques with Charon 4A as a vector . This localization and structural characterization provide the foundation for recombinant expression studies.

What spectroscopic methods are most effective for characterizing recombinant cybB?

Characterization of recombinant cytochrome b561 relies heavily on spectroscopic techniques that can detect its unique properties. The most informative approaches include:

  • UV-Visible Absorption Spectroscopy: The defining characteristic of cytochrome b561 is its maximum absorbance at approximately 561 nm in the reduced state . This technique allows researchers to:

    • Confirm proper folding and heme incorporation

    • Monitor redox state changes

    • Quantify protein concentration

  • Redox Potentiometry: This technique measures the midpoint potentials of the heme centers, providing crucial information about electron transfer capabilities.

  • Electron Paramagnetic Resonance (EPR): Useful for examining the electronic structure of the heme iron centers in different oxidation states.

  • Resonance Raman Spectroscopy: Provides detailed information about heme coordination and environment.

When characterizing recombinant cybB expressed in E. coli systems, these spectroscopic methods can confirm that the protein retains native, fully functional form over a wide pH range, as demonstrated with adrenal cytochrome b561 expressed in E. coli .

What are the optimal expression systems for producing high-yield, functional recombinant cybB?

The development of efficient expression systems for membrane proteins like cytochrome b561 is challenging due to their hydrophobic nature and complex folding requirements. For recombinant cybB, the following expression approach has proven most effective:

E. coli Expression System Advantages:

  • Provides approximately sixfold improvement in yield compared to insect and yeast cell systems

  • Allows for simplified genetic manipulation

  • Enables rapid screening of expression conditions

  • Facilitates isotopic labeling for structural studies

Optimal Expression Parameters:

  • Selection of appropriate E. coli strain (often BL21(DE3) or derivatives)

  • Use of tightly controlled promoters (T7 or similar)

  • Optimization of induction conditions (temperature, IPTG concentration, duration)

  • Supplementation with δ-aminolevulinic acid to enhance heme biosynthesis

  • Low-temperature induction (18-25°C) to improve proper folding

The bacterial expression system developed for cytochrome b561 has demonstrated that the recombinant protein retains spectroscopic and redox properties confirming a native, fully functional form over a wide pH range . Mass spectral analysis has shown that the N-terminal signal peptide remains intact in the recombinant protein , suggesting proper processing in the E. coli system.

What membrane solubilization and purification methods best preserve cybB functionality?

The preservation of functionality during solubilization and purification is critical for obtaining research-grade recombinant cybB. The following methodological approach has proven effective:

Membrane Solubilization:

  • Harvest cells and disrupt via sonication or homogenization

  • Isolate membrane fraction through differential centrifugation

  • Solubilize using mild detergents such as:

    • n-Dodecyl-β-D-maltoside (DDM)

    • n-Octyl-β-D-glucopyranoside (OG)

    • Digitonin (for certain applications)

Purification Protocol:

  • Immobilized metal affinity chromatography (IMAC) using His-tagged constructs

  • Ion exchange chromatography as a secondary purification step

  • Size exclusion chromatography for final polishing and buffer exchange

Critical Considerations:

  • Maintain detergent above critical micelle concentration throughout purification

  • Include glycerol (10-20%) to stabilize the protein

  • Add reducing agents (typically ascorbate) to prevent oxidative damage

  • Consider lipid supplementation to maintain native-like environment

This approach has successfully yielded purified recombinant cytochrome b561 that maintains electron transfer capabilities and appropriate spectroscopic properties , confirming retention of native structure and function.

How can researchers verify the structural integrity and functionality of purified recombinant cybB?

Verification of recombinant cybB integrity requires a multi-faceted approach:

Structural Integrity Assessment:

  • SDS-PAGE and Western blotting: Confirms appropriate molecular weight and immunoreactivity

  • Mass spectrometry: Verifies protein sequence and post-translational modifications

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure composition

  • Size exclusion chromatography: Determines oligomeric state

Functional Characterization:

  • UV-Visible spectroscopy: Confirms proper heme incorporation with characteristic absorption at ~561 nm

  • Redox titrations: Verifies appropriate midpoint potentials

  • Electron transfer assays: Measures ability to transfer electrons using appropriate donors/acceptors

  • Ascorbate reducibility: Tests the protein's ability to be reduced by ascorbate, a defining characteristic of cytochrome b561 proteins

Data Interpretation Table:

ParameterExpected Value for Functional cybBIndication of Compromised Protein
Absorption peakSharp peak at ~561 nm (reduced)Broadened or shifted peak
Heme:protein ratio~2 hemes per protein moleculeLower ratio indicates incomplete heme incorporation
Midpoint potentialWithin range of -50 to +50 mVSignificant deviation suggests altered heme environment
Ascorbate reduction rateRapid reduction upon additionSlow or incomplete reduction
Oligomeric statePrimarily monomeric or dimericAggregation or higher-order oligomers

Studies have shown that recombinant cytochrome b561 expressed in E. coli systems can retain native, fully functional properties over a wide pH range , making this expression system valuable for structure-function studies.

How do the electron transfer mechanisms of recombinant E. coli cybB compare with eukaryotic cytochrome b561?

The electron transfer mechanisms between prokaryotic cybB and eukaryotic cytochrome b561 share fundamental principles while exhibiting important differences:

Similarities:

  • Both contain two heme b centers that facilitate electron transfer

  • Both are membrane-embedded with transmembrane electron transfer capabilities

  • Both involve coordination of heme groups by conserved histidine residues

Key Differences:

  • Eukaryotic cytochrome b561 utilizes ascorbate as an electron donor, with a highly conserved lysine residue (e.g., Lys81 in Arabidopsis) playing an essential role in substrate recognition and catalysis

  • Eukaryotic cytochrome b561 employs a histidine residue (e.g., His106 in Arabidopsis) on the opposite side of the membrane for substrate binding

  • The proposed mechanism for eukaryotic cytochrome b561 involves:

    • Ascorbate binding to a conserved substrate-binding site on the cytoplasmic side

    • Electron donation to one heme, generating monodehydroascorbate

    • Electron transfer to the second heme

    • Reduction of either monodehydroascorbate or ferric-chelate on the opposite side of the membrane

While E. coli cybB shares structural similarities with eukaryotic cytochrome b561, its physiological electron donors and acceptors remain less well-characterized. Research using recombinant systems offers opportunities to explore these differences and potential functional convergences.

How can researchers resolve conflicting data when characterizing recombinant cybB?

When encountering conflicting or contradictory findings in recombinant cybB research, a systematic approach to resolution is essential:

Methodological Approach to Resolving Conflicts:

  • Identify Potential Sources of Variability:

    • Expression conditions affecting protein folding or heme incorporation

    • Differences in purification protocols affecting protein stability

    • Variations in assay conditions (pH, temperature, buffer composition)

    • Differences in protein constructs (tags, truncations, mutations)

  • Standardize Experimental Conditions:

    • Use consistent purification protocols across experiments

    • Standardize spectroscopic measurement conditions

    • Establish reference standards for functional assays

    • Document all experimental parameters thoroughly

  • Deploy Complementary Techniques:

    • Combine multiple spectroscopic methods to cross-validate findings

    • Utilize both in vitro and in vivo functional assays

    • Apply both structural and functional characterization approaches

    • Consider computational modeling to interpret experimental results

  • Systematic Investigation of Variables:

    VariableControlled RangeMeasurement ApproachExpected Impact
    pH5.5-8.5Spectroscopic analysisAffects heme redox potentials and protein stability
    Detergent typeDDM, OG, DigitoninActivity assays, thermal stabilityInfluences membrane protein stability and activity
    Redox conditions±Ascorbate, ±DithioniteUV-Vis spectroscopyDetermines redox state of heme centers
    Temperature4-37°CActivity assays, thermal shiftAffects protein stability and reaction kinetics
  • Integrate Mixed Method Approaches:
    When dealing with conflicting data, combining quantitative and qualitative methods can provide deeper insights. This approach, as discussed in mixed methods research literature , can help identify underlying explanations for apparent contradictions.

The recombinant expression of cytochrome b561 in E. coli has been shown to produce protein that retains native, fully functional form over a wide pH range , suggesting that carefully controlled expression and characterization can minimize conflicting results.

How might recombinant cybB be utilized to understand the evolutionary relationship between prokaryotic and eukaryotic cytochrome b561 proteins?

Recombinant cybB provides a valuable tool for exploring the evolutionary relationships between prokaryotic and eukaryotic cytochrome b561 proteins:

Research Approaches:

  • Comparative structural analysis: Generate high-resolution structures of both prokaryotic and eukaryotic cytochrome b561 proteins to identify conserved structural elements

  • Phylogenetic analysis: Use sequence data to construct evolutionary trees and identify divergence points

  • Functional complementation studies: Test whether E. coli cybB can functionally complement eukaryotic cytochrome b561 in knockout models

  • Domain swapping experiments: Create chimeric proteins combining domains from prokaryotic and eukaryotic proteins to identify functional modules

Key Research Questions:

  • Did the electron transfer function evolve independently or from a common ancestor?

  • How did substrate specificity evolve across different cytochrome b561 proteins?

  • What structural adaptations accommodate different cellular environments?

The high conservation of cytochrome b561 across eukaryotic species suggests important functional roles . Comparing these with prokaryotic cybB could reveal how electron transfer systems adapted to different cellular compartments and metabolic requirements throughout evolution.

What are the most promising applications of recombinant cybB in understanding broader electron transfer mechanisms?

Recombinant cybB offers several promising applications for understanding fundamental aspects of biological electron transfer:

Research Applications:

  • Model system for transmembrane electron transfer: The relatively simple structure of cybB compared to larger electron transport complexes makes it an attractive model system

  • Template for designing synthetic electron transport proteins: Understanding the minimal requirements for transmembrane electron transfer

  • Scaffold for incorporating non-native cofactors: Testing the effects of modified hemes or alternative metal centers

  • Platform for developing novel redox sensors: Engineering cybB variants with altered redox potentials or substrate specificity

Methodological Approaches:

  • Time-resolved spectroscopy: Measuring electron transfer kinetics at microsecond to picosecond timescales

  • Single-molecule techniques: Observing individual electron transfer events

  • Electrochemical methods: Integrating recombinant cybB into electrode systems to study direct electron transfer

  • Computational modeling: Simulating electron transfer pathways and energetics

The established E. coli expression system for cytochrome b561 offers substantial advantages over existing insect and yeast cell systems , making these advanced applications more accessible to researchers.

How can structural insights from recombinant cybB inform the development of novel electron transfer proteins?

Structural information derived from recombinant cybB research can guide the rational design of novel electron transfer proteins:

Design Principles:

  • Minimal heme-binding motifs: Identify the essential structural elements required for proper heme coordination

  • Optimal transmembrane architecture: Determine the ideal spacing and orientation of transmembrane helices for efficient electron transfer

  • Tunable redox potentials: Understand how the protein environment modulates heme redox potentials

  • Substrate binding sites: Design specific binding pockets for various electron donors and acceptors

Applications in Synthetic Biology:

  • Artificial photosynthetic systems: Creating membrane-bound electron transfer components

  • Bioelectronic interfaces: Developing proteins that can communicate with electrodes

  • Biocatalysis: Engineering redox enzymes with specific electron transfer properties

  • Biosensors: Designing proteins that produce measurable signals upon redox changes

The crystal structures of cytochrome b561 proteins, such as those from Arabidopsis thaliana in both substrate-free and substrate-bound states , provide crucial templates for understanding the structural basis of function. Similar structural studies of recombinant E. coli cybB would further expand this knowledge base.

What are the most common challenges in expressing recombinant cybB and how can they be addressed?

Researchers often encounter several challenges when expressing recombinant cybB in E. coli systems:

Challenge 1: Low Expression Levels

  • Cause: Toxicity of membrane protein overexpression, inefficient transcription/translation

  • Solution:

    • Use tightly regulated promoters (e.g., PBAD, T7lac)

    • Lower induction temperature (16-25°C)

    • Explore different E. coli strains (C41(DE3), C43(DE3) for toxic membrane proteins)

    • Optimize codon usage for E. coli expression

Challenge 2: Improper Folding/Aggregation

  • Cause: Rapid expression overwhelming membrane insertion machinery, insufficient chaperones

  • Solution:

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Use slow induction protocols (low inducer concentration)

    • Add membrane-stabilizing agents (glycerol, specific lipids)

Challenge 3: Incomplete Heme Incorporation

  • Cause: Insufficient heme biosynthesis to match protein production

  • Solution:

    • Supplement growth medium with δ-aminolevulinic acid (precursor for heme biosynthesis)

    • Adjust iron availability in growth medium

    • Consider exogenous heme supplementation in certain cases

Challenge 4: Poor Membrane Extraction

  • Cause: Tight association with membrane components, suboptimal detergent selection

  • Solution:

    • Screen multiple detergents for optimal extraction

    • Optimize detergent:protein ratio

    • Consider detergent mixtures for improved solubilization

The development of optimized E. coli expression systems has demonstrated sixfold improvement in yield compared to insect and yeast cell systems , suggesting that these challenges can be effectively addressed with proper methodology.

How can researchers distinguish between native and non-native conformations of recombinant cybB?

Distinguishing between native and non-native conformations of recombinant cybB is critical for ensuring experimental validity:

Spectroscopic Indicators:

  • UV-Visible Spectroscopy:

    • Native protein: Sharp Soret peak, distinct α and β bands in the visible region

    • Non-native: Broadened Soret peak, altered or diminished α/β bands

  • Circular Dichroism (CD):

    • Native protein: CD spectrum consistent with predicted secondary structure

    • Non-native: Altered CD spectrum indicating structural perturbations

Functional Indicators:

  • Redox Properties:

    • Native protein: Expected midpoint potentials for both heme centers

    • Non-native: Shifted potentials or non-reversible redox behavior

  • Ascorbate Reducibility:

    • Native protein: Rapid and complete reduction by ascorbate

    • Non-native: Slow, incomplete, or absent reduction

Stability Indicators:

  • Thermal Stability:

    • Native protein: Cooperative unfolding transition

    • Non-native: Multiple transitions or gradual unfolding

  • Detergent Sensitivity:

    • Native protein: Stable in mild detergents, consistent spectral properties

    • Non-native: Highly sensitive to detergent changes, variable spectral properties

Studies have shown that recombinant cytochrome b561 expressed in E. coli systems can retain native, fully functional form over a wide pH range , providing a reference point for proper folding and function.

What analytical methods are most effective for detecting heterogeneity in recombinant cybB preparations?

Detecting and characterizing heterogeneity in recombinant cybB preparations requires multiple complementary analytical approaches:

Approaches for Detecting Heterogeneity:

  • Size Exclusion Chromatography (SEC):

    • Separates based on hydrodynamic radius

    • Identifies oligomeric states and aggregates

    • Can be coupled with multi-angle light scattering (SEC-MALS) for absolute molecular weight determination

  • Analytical Ultracentrifugation (AUC):

    • Provides information on size, shape, and conformational heterogeneity

    • Sedimentation velocity experiments detect multiple species

    • Equilibrium experiments determine absolute molecular weights

  • Native PAGE:

    • Separates proteins based on size and charge while preserving native structure

    • Can detect different oligomeric states or conformational variants

  • Mass Spectrometry:

    • Native MS can detect intact protein complexes

    • Hydrogen/deuterium exchange MS can identify regions with conformational flexibility

    • Mass spectral analysis can confirm if the N-terminal signal peptide is intact

  • Electron Microscopy:

    • Negative stain EM provides information on particle size distribution and homogeneity

    • Cryo-EM can reveal structural heterogeneity at near-atomic resolution

Heterogeneity Analysis Table:

Analytical MethodInformation ProvidedAdvantagesLimitations
SECHydrodynamic size distributionSimple, non-destructiveLimited resolution between similar species
AUCSedimentation coefficient distributionHigh resolution, first-principles approachTime-consuming, requires specialized equipment
Native PAGECharge and size heterogeneitySimple, widely accessibleSemi-quantitative, potential detergent interference
Mass SpectrometryMass differences, post-translational modificationsHigh sensitivity, provides exact massesCan be affected by ionization efficiency
Fluorescence SpectroscopyConformational ensembleSensitive to subtle structural changesIndirect measurement, requires intrinsic/extrinsic probes

The development of optimized purification protocols for recombinant cytochrome b561 in E. coli systems has demonstrated that homogeneous, functional protein can be obtained , suggesting that heterogeneity can be minimized with appropriate methodology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.