Recombinant Escherichia coli Cytochrome o ubiquinol oxidase protein CyoD (cyoD)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Cytochrome bo<sub>3</sub> Complex

CyoD is indispensable for:

  • Assembly of the Oxidase Complex: Facilitates Cu<sub>B</sub> incorporation into the heme-copper binuclear center in subunit I .

  • Proton Pumping: Supports the structural integrity required for coupling electron transfer to proton translocation .

  • Dimer Stabilization: Mediates interactions between subunit II of one monomer and subunit IV of another in the dimeric form .

Deletion of CyoD’s C-terminal region (Val45–His109) disrupts oxidase activity and Cu<sub>B</sub> binding, confirming its role in redox center assembly .

Genetic and Biochemical Studies

  • Gene Fusion Experiments: Subunits I–III can be genetically fused without disrupting activity, but CyoD remains essential for Cu<sub>B</sub> coordination .

  • Purification Protocols: Affinity chromatography yields a four-subunit complex (I–IV), with CyoD confirmed via SDS-PAGE and cross-linking assays .

  • Metal Content: The purified complex contains 2 Fe atoms and 1 Cu atom per monomer, with CyoD contributing to Cu<sub>B</sub> stability .

Comparative Analysis with Related Oxidases

FeatureCyo (E. coli)Mitochondrial aa<sub>3</sub>-Type Oxidase
Subunit IV HomologyCyoD (no aa<sub>3</sub> homology) None
Cu<sub>A</sub> SiteAbsent Present
Quinol SubstrateUbiquinol-8 Cytochrome c

CyoD’s lack of homology to mitochondrial subunits underscores its specialized role in bacterial quinol oxidation .

Applications and Implications

  • Bioenergetics Research: CyoD’s role in proton pumping provides insights into bacterial respiratory efficiency .

  • Biotechnology: Recombinant CyoD aids in engineering oxidases for synthetic bioenergetic systems .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cyoD; b0429; JW0419; Cytochrome bo(3 ubiquinol oxidase subunit 4; Cytochrome o ubiquinol oxidase subunit 4; Cytochrome o subunit 4; Oxidase bo(3 subunit 4; Ubiquinol oxidase chain D; Ubiquinol oxidase polypeptide IV; Ubiquinol oxidase subunit 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
cyoD
Target Protein Sequence
MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAVILGTILAMAVVQVLV HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMMMH
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is a component of the aerobic respiratory chain in E.coli, predominantly expressed when cells are grown under high aeration conditions. It exhibits proton pump activity across the membrane, in addition to electron transfer, pumping 2 protons/electron.
Gene References Into Functions
  1. No evidence of a low affinity ubiquinone binding site in cytochrome bo3 from Escherichia coli. PMID: 28235459
Database Links
Protein Families
Cytochrome c oxidase bacterial subunit 4 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of CyoD in the cytochrome bo oxidase complex?

CyoD is subunit IV of the cytochrome bo ubiquinol oxidase complex in Escherichia coli. Unlike subunit IV in cytochrome c oxidases which contains a single transmembrane helix, CyoD possesses three membrane-spanning helices based on hydropathy analysis and topological studies. These helices are integrated within the membrane bilayer, with one of the transmembrane helices aligning almost exactly with the position of the single transmembrane helix in subunit IV of cytochrome c oxidase. The remaining density appears closely attached to subunit III of the complex. Cross-linking studies indicate that CyoD is in close proximity to both subunits I and III of the cytochrome bo complex .

How does the cytochrome bo oxidase complex differ from cytochrome bd oxidase?

The cytochrome bo and cytochrome bd oxidases represent distinct terminal oxidase families in E. coli. While both catalyze the reduction of oxygen to water, they differ in several key aspects:

FeatureCytochrome bo oxidaseCytochrome bd oxidase
SubfamilyHaem-copper oxidaseNon-haem-copper oxidase
StructureContains CyoA, CyoB, CyoC, CyoD subunitsContains CydA, CydB, CydX subunits
Oxygen affinityLower affinityHigher affinity (functions at low O₂)
Proton pumpingProton pumpNon-proton pumping
Expression conditionsPredominant at high O₂Predominant at low O₂
Small protein componentCyoD (multiple transmembrane helices)CydX (single transmembrane helix)

The cytochrome bd oxidase helps bacteria survive in low-oxygen conditions and provides protection against cytotoxic agents released by host immune systems, making it important for bacterial survival during infection .

What are the optimal conditions for expressing recombinant CyoD in E. coli?

For optimal expression of recombinant CyoD, researchers should consider using restricted dissolved oxygen (DO) conditions. Evidence from similar membrane protein expression studies shows that restricted DO can significantly improve the expression of membrane proteins, especially those from anaerobic origin or with complex membrane integration requirements. In restricted DO conditions, fewer genes are differentially expressed (2.5 times lower than in unrestricted oxygen conditions), and fewer ribosome formation genes are down-regulated (7.4 times smaller number), which can enhance translation efficiency .

The expression is also improved through up-regulation of heat shock chaperones involved in protein folding (24 chaperones have been observed to be up-regulated in restricted DO) and the global regulator RNA chaperone hfq. When using restricted DO, mRNA levels can be approximately 5-fold higher, and protein expression can be up to 27-fold higher compared to unrestricted DO conditions .

For expressing CyoD specifically, consider:

  • Using E. coli strains optimized for membrane protein expression (C41(DE3), C43(DE3))

  • Maintaining cultures at lower temperatures (16-25°C)

  • Using lower inducer concentrations

  • Employing tightly controlled induction systems like pBAD

  • Implementing controlled oxygen limitation during the expression phase

What purification strategies yield the highest purity of recombinant CyoD?

Purifying recombinant CyoD requires specialized approaches due to its hydrophobic nature and multiple transmembrane domains. An effective purification strategy includes:

  • Membrane Extraction: Harvest cells and disrupt by sonication or French press. Isolate membrane fractions through ultracentrifugation (typically 100,000 × g for 1 hour).

  • Solubilization: Carefully select detergents that maintain protein structure and function. For CyoD, mild detergents like n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration are often effective. Solubilize for 1-2 hours at 4°C with gentle agitation.

  • Affinity Chromatography: If CyoD is tagged (His-tag recommended), use immobilized metal affinity chromatography (IMAC). Wash extensively with buffer containing low detergent concentration (0.05-0.1% DDM) and low imidazole (20-30 mM) to remove non-specific binding. Elute with an imidazole gradient up to 500 mM.

  • Size Exclusion Chromatography: Further purify using SEC to separate different oligomeric states and remove aggregates. Use a buffer containing 0.05% DDM, 150 mM NaCl, and 20 mM Tris-HCl pH 7.5.

The purification can be monitored using SDS-PAGE, Western blotting, and activity assays if CyoD is purified as part of the intact cytochrome bo complex. Pure CyoD typically appears as a band around 12-14 kDa on SDS-PAGE gels, though its apparent molecular weight may vary due to its hydrophobic nature .

How can researchers assess the functional integrity of recombinant CyoD?

Assessing the functional integrity of recombinant CyoD involves both direct and indirect approaches:

  • Co-purification with CyoABC: CyoD's primary role is as part of the cytochrome bo complex. Successful co-purification with other subunits indicates proper folding and interaction capability. Similar to approaches used for CydX in cytochrome bd oxidase, researchers can tag CyoD (SPA-tag or His-tag) and assess whether other complex components co-purify, indicating intact interactions .

  • Oxidase Activity Assays: When expressing the complete cytochrome bo complex, measure TMPD (N,N,N′,N′-tetramethyl-p-phenylenediamine) oxidation spectrophotometrically at 611 nm. Active complexes containing properly integrated CyoD will show higher oxidation rates compared to complexes lacking CyoD or containing misfolded CyoD .

  • Complementation Studies: In E. coli strains with deleted cyoD, introduce the recombinant cyoD gene and assess restoration of oxidase activity and aerobic growth phenotypes. Complete restoration indicates functional CyoD.

  • Membrane Integration Analysis: Use alkaline extraction or protease accessibility assays to confirm proper membrane integration. In alkaline extraction, properly integrated membrane proteins remain in the pellet fraction after treatment with carbonate buffer (pH 11), while peripheral proteins are released into the supernatant.

  • Circular Dichroism Spectroscopy: Assess the secondary structure content to confirm proper folding of purified CyoD. The spectrum should show characteristics consistent with a protein containing predominantly α-helical structures typical of transmembrane domains.

What experimental approaches can reveal the interaction network of CyoD within the cytochrome bo complex?

Understanding CyoD's interaction network requires multiple complementary approaches:

  • Chemical Cross-linking Mass Spectrometry (XL-MS): Use cross-linking reagents with different spacer lengths (DSS, BS3, or EDC) to identify proteins in proximity to CyoD. After cross-linking, digest proteins, analyze by LC-MS/MS, and identify cross-linked peptides using specialized software like pLink or xQuest. This approach has previously revealed that CyoD is proximal to subunits I and III of the complex .

  • Co-immunoprecipitation (Co-IP): Express tagged CyoD in E. coli and perform Co-IP to identify interacting partners. Use stringent washing conditions to eliminate non-specific interactions.

  • Site-specific Photocrosslinking: Incorporate photoreactive amino acid analogs (like p-benzoyl-L-phenylalanine) at specific positions in CyoD using amber suppression technology. After UV activation, crosslinked products can be analyzed by mass spectrometry to identify precise interaction sites.

  • Surface Plasmon Resonance (SPR): Purify individual components of the complex and measure binding kinetics between CyoD and other subunits to quantify interaction strengths.

  • Two-hybrid Membrane Protein Interaction Systems: Use bacterial two-hybrid systems specifically adapted for membrane proteins, such as BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system, to screen for interactions in vivo.

  • Cryo-electron Microscopy: For structural characterization of the entire complex, cryo-EM at high resolution can reveal the precise positioning of CyoD relative to other subunits, as has been done for related oxidase complexes at resolutions of 6Å or better .

How does the three-dimensional structure of CyoD differ from its homologs in other bacterial species?

CyoD from E. coli has three predicted transmembrane helices, which distinguishes it from the single-helix subunit IV found in cytochrome c oxidases from organisms like Paracoccus denitrificans. Electron crystallography studies have revealed that one of CyoD's transmembrane helices aligns almost exactly with the position of the single transmembrane helix in subunit IV of cytochrome c oxidase, while the other helices form additional contacts with subunit III .

Structural comparisons based on hydropathy analyses and limited crystallographic data suggest several key differences:

  • Helix Organization: E. coli CyoD contains three transmembrane helices arranged in a specific orientation relative to other subunits, while homologs in other species may have fewer transmembrane segments.

  • Interaction Interfaces: The additional helices in E. coli CyoD create more extensive interaction surfaces with subunits I and III compared to single-helix homologs.

  • Membrane Topology: The orientation of the N and C termini relative to the membrane differs between CyoD and its homologs based on topological studies.

Advanced structural studies, including high-resolution cryo-electron microscopy of the entire cytochrome bo complex, are needed to fully elucidate these structural differences. The current projection map at 6Å resolution provides evidence for these structural features but lacks the detail necessary for comprehensive comparison .

How does CyoD contribute to E. coli's adaptation to different oxygen environments?

CyoD, as part of the cytochrome bo ubiquinol oxidase complex, plays a significant role in E. coli's adaptation to varying oxygen concentrations:

  • High-Oxygen Environments: The cytochrome bo oxidase complex containing CyoD is predominantly expressed under high-oxygen conditions, in contrast to cytochrome bd oxidases that dominate under microaerobic conditions. CyoD's structural role in maintaining the integrity of the cytochrome bo complex ensures efficient aerobic respiration when oxygen is abundant .

  • Respiratory Flexibility: E. coli possesses multiple terminal oxidases (including cytochrome bo and two bd-type oxidases) that are differentially expressed depending on oxygen availability. This respiratory flexibility allows E. coli to thrive across a wide range of oxygen concentrations. CyoD specifically contributes to respiration at higher oxygen levels where the cytochrome bo complex is most active .

  • Energy Efficiency: The cytochrome bo complex generates a proton motive force with greater efficiency than cytochrome bd oxidases under high-oxygen conditions. CyoD's contribution to maintaining the structural integrity of this complex supports this energetic advantage.

  • Oxidative Stress Response: While cytochrome bd oxidases are known to protect against oxidative stress, the cytochrome bo complex containing CyoD may have complementary roles in managing oxidative stress under specific conditions, though this is less well characterized than the protective functions of cytochrome bd oxidases .

Understanding these contributions requires comparative studies of wild-type E. coli versus cyoD deletion mutants across oxygen gradients, measuring growth rates, terminal oxidase activities, and respiration efficiencies.

What evidence exists for post-translational modifications of CyoD affecting its function?

  • Phosphorylation: Cytoplasmic loops in membrane proteins are often subject to phosphorylation by bacterial kinases. These modifications can alter protein-protein interactions or change conformational dynamics of the complex.

  • Proteolytic Processing: N-terminal or C-terminal processing may occur during maturation and membrane insertion. This processing could be essential for proper folding and integration into the complex.

  • Disulfide Bond Formation: Any cysteine residues in CyoD could potentially form disulfide bonds that stabilize protein structure, though this would be dependent on the local redox environment.

To investigate potential PTMs in CyoD, researchers should employ:

  • Mass spectrometry-based proteomics approaches on purified CyoD to identify any modifications

  • Site-directed mutagenesis of potential modification sites followed by functional assays

  • Comparison of CyoD's electrophoretic mobility under various cellular conditions

  • Phosphoproteomic analysis of E. coli membrane fractions

These approaches would help establish whether PTMs play a significant role in regulating CyoD function or if its activity is primarily determined by its primary sequence and expression level.

What strategies can overcome the challenges of expressing and purifying sufficient quantities of functional CyoD for structural studies?

Obtaining sufficient quantities of properly folded CyoD presents significant challenges due to its hydrophobic nature and multiple transmembrane domains. Advanced strategies to overcome these challenges include:

  • Oxygen-Restricted Expression Systems: Implementing controlled oxygen limitation during expression can significantly enhance yields. Studies have shown that restricted dissolved oxygen (DO) conditions can increase expression of membrane proteins by up to 27-fold compared to unrestricted DO conditions. This approach leverages the finding that under restricted DO, fewer ribosome formation genes are down-regulated, and more heat shock chaperones involved in protein folding are up-regulated .

  • Fusion Protein Approaches: Fusing CyoD to solubility-enhancing partners like MBP (maltose-binding protein) or SUMO can improve expression and folding. These fusion partners can be removed by specific proteases after purification.

  • Cell-Free Expression Systems: Using E. coli extract-based cell-free systems supplemented with lipids or detergents can directly produce CyoD in a soluble form, bypassing issues related to toxicity and inclusion body formation.

  • Nanodiscs and Amphipols: For structural studies, reconstituting purified CyoD into nanodiscs (disc-shaped phospholipid bilayers surrounded by scaffold proteins) or stabilizing with amphipols can maintain native-like environments without traditional detergents.

  • Co-expression with Chaperones: Co-expressing CyoD with chaperones (GroEL/GroES, DnaK/DnaJ/GrpE) can enhance proper folding. This approach is particularly effective when combined with restricted oxygen conditions that naturally up-regulate heat shock chaperones .

  • Two-stage Continuous Culture: Using a two-stage continuous culture system where cells first grow under aerobic conditions to achieve high biomass, followed by a second stage with restricted oxygen for optimal expression.

These strategies can be combined for additive benefits, potentially yielding sufficient quantities of properly folded CyoD for structural studies including X-ray crystallography or cryo-electron microscopy.

How can researchers design effective site-directed mutagenesis studies to elucidate CyoD function?

Designing effective site-directed mutagenesis studies for CyoD requires a strategic approach:

  • Rational Selection of Mutation Targets:

    • Highly conserved residues identified through multiple sequence alignments

    • Charged or polar residues within transmembrane segments (unusual and often functionally important)

    • Residues in predicted interaction interfaces with other subunits

    • Amino acids at membrane-water interfaces

    • Potential PTM sites

  • Types of Mutations to Consider:

    • Conservative substitutions (e.g., Leu→Ile) to assess structural roles

    • Charge reversals (e.g., Asp→Lys) to disrupt electrostatic interactions

    • Cysteine scanning mutagenesis for accessibility studies

    • Alanine scanning of specific regions to identify essential residues

    • Introduction of flexible glycine residues in helical regions

  • Functional Readouts:

    • Growth phenotypes under aerobic conditions

    • TMPD oxidase activity assays of membrane fractions

    • Complex assembly assessment via co-immunoprecipitation

    • Membrane integration analysis

    • Thermal stability measurements

  • Experimental Design Considerations:

    • Express mutants at near-physiological levels to avoid artifacts

    • Include positive controls (wild-type) and negative controls (deletion mutants)

    • Use complementation assays in cyoD deletion strains

    • Consider the effect of restricted versus unrestricted oxygen conditions on expression

  • Advanced Approaches:

    • Create cysteine pairs for disulfide cross-linking to assess proximity

    • Introduce fluorescent amino acids for spectroscopic studies

    • Design split-protein complementation systems to monitor assembly

Similar studies on the small protein CydX (a subunit of cytochrome bd oxidase) revealed that few individual amino acids were essential for function when overexpressed, suggesting that comprehensive mutagenesis approaches may be necessary to identify critical residues in CyoD .

How does CyoD's role differ from homologous subunits in other terminal oxidases across bacterial species?

CyoD exhibits significant structural and functional differences from homologous subunits in other terminal oxidases:

  • Structural Differences: Unlike subunit IV in cytochrome c oxidases from Paracoccus denitrificans which contains a single transmembrane helix, E. coli CyoD possesses three membrane-spanning helices. Electron microscopy studies at 6Å resolution show that while one of CyoD's helices aligns with the position of subunit IV in cytochrome c oxidase, additional density corresponds to the other transmembrane segments unique to CyoD .

  • Substrate Adaptation: CyoD likely contributes to the structural adaptations necessary for ubiquinol utilization rather than cytochrome c. Ubiquinol is a small, hydrophobic molecule (molecular weight <1000 Da) and a two-electron donor, whereas cytochrome c is a soluble protein (12,000-14,000 Da) and a one-electron donor. These differences in electron donors require distinct binding sites and electron transfer pathways .

  • Species-Specific Adaptations: In some bacterial species, homologs of CyoD may play more direct roles in catalysis or substrate binding, while in others (including E. coli), the evidence suggests primarily structural and assembly functions.

  • Regulatory Responses: The expression patterns and regulatory responses of CyoD and its homologs differ across bacterial species, reflecting adaptation to specific ecological niches and oxygen availability patterns.

Comparative genomic and structural analyses across diverse bacterial species would further elucidate the evolutionary adaptations of these homologous subunits to different respiratory strategies and environments.

How do genetic variations in cyoD affect cytochrome bo oxidase activity across different E. coli strains?

Genetic variations in cyoD can significantly impact cytochrome bo oxidase activity across E. coli strains:

  • Natural Variations: Different E. coli strains and isolates contain single nucleotide polymorphisms (SNPs) in the cyoD gene that may affect:

    • Protein stability and half-life

    • Efficiency of assembly into the cytochrome bo complex

    • Interaction strength with other subunits

    • Membrane integration efficiency

  • Functional Consequences: These variations can lead to strain-specific differences in:

    • Growth rates under aerobic conditions

    • Oxygen consumption rates

    • Proton pumping efficiency

    • Resistance to respiratory inhibitors

    • Adaptation to varying oxygen tensions

  • Methodological Approaches to Study Variation Effects:

    • Comparative genomics to identify natural variations

    • Allelic exchange experiments to swap cyoD variants between strains

    • In vitro reconstitution with different CyoD variants

    • Growth fitness assays under various oxygen conditions

    • Direct measurement of proton pumping activity

  • Evolutionary Implications: Variations in cyoD may reflect adaptations to specific ecological niches or host environments. Laboratory strains maintained under constant aerobic conditions may harbor different variants than clinical or environmental isolates that experience fluctuating oxygen levels.

A systematic analysis comparing cytochrome bo oxidase activity in diverse E. coli isolates, coupled with sequencing of the cyoD gene, would provide valuable insights into the functional consequences of these genetic variations and their adaptive significance.

What are the most common technical issues when working with recombinant CyoD and how can they be resolved?

Researchers frequently encounter several technical challenges when working with recombinant CyoD:

  • Low Expression Levels

    • Issue: CyoD often expresses poorly in standard conditions.

    • Solution: Implement restricted dissolved oxygen (DO) conditions, which can increase expression up to 27-fold. Under restricted DO, fewer ribosome formation genes are down-regulated, and more heat shock chaperones involved in protein folding are up-regulated . Additionally, consider using specialized E. coli strains designed for membrane protein expression (C41/C43) and lower induction temperatures (16-20°C).

  • Protein Aggregation During Purification

    • Issue: CyoD may aggregate during extraction from membranes.

    • Solution: Optimize detergent selection and concentration. Initial screening with a panel of detergents (DDM, LMNG, digitonin) at various concentrations is crucial. Add glycerol (10-20%) to stabilize the protein and prevent aggregation. Consider using amphipathic polymers like amphipols as alternatives to detergents for improved stability.

  • Loss of Interaction Partners

    • Issue: CyoD may separate from other complex components during purification.

    • Solution: Use milder solubilization conditions and consider co-expression strategies where multiple subunits are expressed simultaneously. Cross-linking prior to solubilization can also help maintain subunit interactions.

  • Difficult Detection

    • Issue: CyoD's small size makes detection challenging.

    • Solution: Use specialized SDS-PAGE systems for small proteins (Tricine-SDS-PAGE) and consider C-terminal rather than N-terminal tags to improve detection. Western blotting with specialized antibodies or against epitope tags can enhance sensitivity.

  • Functional Assessment Challenges

    • Issue: Determining if purified CyoD is properly folded and functional.

    • Solution: Assess multiple parameters including secondary structure (by circular dichroism), thermal stability, and ability to reconstitute with other subunits to form a functional complex. TMPD oxidase activity assays of reconstituted complexes can confirm functionality .

How can researchers distinguish between direct and indirect effects when studying CyoD mutations?

Distinguishing between direct and indirect effects of CyoD mutations requires a multi-faceted approach:

  • Comprehensive Mutational Analysis

    • Create a library of mutations ranging from conservative to radical changes

    • Compare mutations at different positions with similar chemical changes

    • Use domain swapping with homologous proteins to identify functional regions

  • Structural Assessment

    • Analyze whether mutations affect CyoD stability using thermal shift assays

    • Determine if mutations alter membrane integration using alkaline extraction

    • Assess secondary structure changes using circular dichroism spectroscopy

  • Proximity and Interaction Studies

    • Use site-specific cross-linking to determine if mutations disrupt specific interactions

    • Employ FRET (Förster Resonance Energy Transfer) with fluorescently labeled components to measure distances between subunits

    • Perform co-purification experiments to quantify changes in binding affinities

  • Control Experiments

    • Examine effects of mutations in isolated CyoD versus the intact complex

    • Develop compensation mutations in interacting partners that restore function

    • Use chemical rescue approaches for certain types of mutations

  • Complementation Analysis

    • Express mutant variants at physiological levels rather than overexpression

    • Test functionality in the context of a clean cyoD deletion background

    • Analyze growth phenotypes under various stress conditions

By applying these approaches systematically, researchers can build evidence to distinguish mutations that directly affect CyoD function from those that indirectly impact the cytochrome bo complex through structural perturbations or assembly defects. This distinction is critical for developing accurate models of CyoD's role in the complex.

What are the most promising approaches for determining the high-resolution structure of CyoD within the cytochrome bo complex?

Several cutting-edge approaches show promise for elucidating the high-resolution structure of CyoD within the cytochrome bo complex:

  • Cryo-Electron Microscopy (Cryo-EM)

    • Single-particle cryo-EM has revolutionized membrane protein structural biology

    • Previous electron crystallography studies achieved 6Å resolution, but modern cryo-EM could reach 3Å or better

    • Sample preparation using amphipols or nanodiscs can maintain native-like lipid environments

    • Direct electron detectors and improved image processing algorithms enhance resolution

  • Integrative Structural Biology Approaches

    • Combine multiple data sources: cryo-EM, cross-linking mass spectrometry (XL-MS), electron paramagnetic resonance (EPR)

    • Use computational modeling to integrate diverse structural constraints

    • Apply hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map solvent-accessible surfaces and protein dynamics

  • X-ray Crystallography of Stabilized Complexes

    • Engineer fusion proteins or binding partners to facilitate crystallization

    • Use antibody fragments (Fabs) to provide crystal contacts

    • Apply lipidic cubic phase crystallization methods optimized for membrane proteins

    • Screen detergent/lipid combinations systematically to identify conditions promoting crystal formation

  • AlphaFold and Deep Learning Approaches

    • Leverage recent advances in protein structure prediction

    • Use predicted models to design experiments validating structural features

    • Develop specialized versions of structure prediction algorithms optimized for membrane protein complexes

  • Site-Specific Spectroscopic Approaches

    • Incorporate unnatural amino acids for site-specific labeling

    • Use double electron-electron resonance (DEER) spectroscopy to measure distances between labeled sites

    • Apply solid-state NMR to determine local structural features in membrane-embedded regions

These approaches have already yielded high-resolution structures for related membrane protein complexes, suggesting they could be successfully applied to determine the structure of CyoD within the cytochrome bo oxidase complex .

How might understanding CyoD function contribute to developing new antimicrobial strategies?

Understanding CyoD function could open several avenues for novel antimicrobial development:

  • Targeted Inhibition of Bacterial Respiration

    • The cytochrome bo oxidase is essential for efficient aerobic respiration in many pathogenic bacteria

    • Structural insights into CyoD and its interactions could enable design of small molecules that disrupt complex assembly or function

    • Such inhibitors would specifically target bacterial respiration without affecting human mitochondrial complexes that lack CyoD homologs

  • Exploitation of Species-Specific Differences

    • CyoD structural features differ from those in cytochrome c oxidase subunits

    • These differences could be exploited to develop compounds that selectively inhibit bacterial cytochrome bo oxidases

    • Comparative analysis across bacterial species could identify conserved features for broad-spectrum activity

  • Attenuation Strategies for Live Vaccines

    • Engineered mutations in cyoD could create attenuated bacterial strains for vaccine development

    • These strains would show reduced fitness under oxygen-rich conditions but maintain immunogenicity

    • Similar approaches targeting respiratory chains have shown promise in vaccine development

  • Synergistic Therapeutic Approaches

    • Targeting CyoD function could enhance the efficacy of existing antibiotics

    • Inhibiting cytochrome bo oxidase increases bacterial susceptibility to oxidative stress

    • Combination therapies coupling respiratory inhibitors with immune stimulants could be particularly effective

  • Biofilm Disruption

    • Respiration and energy generation are critical for biofilm formation and maintenance

    • Inhibiting CyoD function could disrupt biofilm formation in pathogenic bacteria

    • This approach could be especially valuable against chronic infections with biofilm components

The growing problem of antimicrobial resistance necessitates novel targets and approaches. As a component of a critical respiratory enzyme absent in humans, CyoD represents a promising candidate for selective antimicrobial development. Further research into its structure and function could yield significant advances in this important field.

What are the key takeaways about CyoD structure and function that researchers should consider when designing experiments?

CyoD in E. coli represents an important subunit of the cytochrome bo ubiquinol oxidase complex with several key characteristics that should inform experimental design:

  • Structural Complexity: CyoD contains three transmembrane helices, distinguishing it from the single-helix subunit IV in cytochrome c oxidases. This structural complexity requires careful consideration when designing expression systems, purification protocols, and structural studies .

  • Expression Optimization: Restricted dissolved oxygen conditions significantly improve expression of membrane proteins like CyoD, with evidence showing up to 27-fold increases in protein expression compared to unrestricted oxygen conditions .

  • Functional Integration: CyoD appears primarily involved in structural stability and assembly of the cytochrome bo complex rather than direct catalytic activity. Experimental designs should consider this when interpreting the effects of mutations or manipulations .

  • Evolutionary Context: The differences between CyoD and homologous subunits in other oxidases reflect adaptations to different electron donors (ubiquinol vs. cytochrome c) and respiratory strategies. Comparative approaches can provide valuable insights into function .

  • Technical Challenges: CyoD's small size and hydrophobic nature present specific technical challenges for detection, purification, and structural studies. Specialized approaches including optimal detergent selection, customized purification protocols, and advanced structural biology techniques are necessary.

Researchers should approach CyoD studies with an integrated perspective, considering both its specific role in E. coli respiration and its broader significance in bacterial energetics and adaptation to varying oxygen environments.

How has our understanding of small protein subunits in respiratory complexes evolved, and what does this suggest about future research priorities?

Our understanding of small protein subunits in respiratory complexes has undergone significant evolution:

  • From Overlooked to Essential: Small proteins like CyoD and CydX were historically overlooked in biochemical studies due to technical limitations in detecting and analyzing small hydrophobic proteins. Current research recognizes these components as essential for complex assembly and function. For example, CydX has been definitively shown to be required for cytochrome bd oxidase activity, suggesting similar importance for other small subunits .

  • Recognition of Widespread Distribution: Bioinformatic analyses have revealed that small protein subunits are conserved across many bacterial species, indicating fundamental roles rather than species-specific adaptations. The conservation of these small proteins in diverse bacterial lineages suggests strong evolutionary selection pressure .

  • Functional Diversity Discovery: Initially thought to be merely structural, small proteins are now recognized to potentially have diverse functions including complex stabilization, assembly facilitation, and possibly regulatory roles. These discoveries highlight the need for comprehensive functional characterization.

  • Technical Advancement Impact: Improvements in proteomics, structural biology, and genetic manipulation techniques have enabled detailed studies of these previously challenging proteins. The application of these advanced techniques has been crucial in revealing the significance of small protein subunits.

Future research priorities should include:

  • Comprehensive Structural Studies: Determining high-resolution structures of complete respiratory complexes including their small protein subunits using advanced cryo-EM and integrative structural biology approaches.

  • Dynamics and Regulation: Investigating whether small proteins contribute to dynamic regulation of respiratory complex activity in response to environmental changes.

  • Systems-Level Understanding: Exploring how different small proteins in various respiratory complexes collectively contribute to cellular energetics and adaptation to environmental conditions.

  • Therapeutic Applications: Leveraging unique features of these small proteins for developing targeted antimicrobials against pathogenic bacteria.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.