Recombinant Escherichia coli Cytochrome o ubiquinol oxidase subunit 3 (cyoC)

Shipped with Ice Packs
In Stock

Description

Overview of cyoC

The cytochrome o ubiquinol oxidase subunit 3 (cyoC) is a core component of the E. coli cytochrome bo<sub>3</sub> ubiquinol oxidase complex, a four-subunit heme-copper oxidase central to aerobic respiration. This enzyme catalyzes the oxidation of ubiquinol (UQH<sub>2</sub>) to ubiquinone (UQ) and the four-electron reduction of oxygen to water, while pumping protons across the bacterial membrane . Recombinant cyoC (accession P0ABJ3) is a truncated, engineered version of the native subunit, optimized for expression and purification in heterologous systems. It spans 204 amino acids and contains five transmembrane helices, distinguishing it from eukaryotic homologs with additional spans .

Production and Purification

Recombinant cyoC is produced via heterologous expression, typically in E. coli, with an N-terminal His-tag for affinity chromatography . Key steps include:

  1. Expression: Inducible promoters (e.g., T7-lac) drive cyoC synthesis in E. coli strains like BL21(DE3) .

  2. Membrane Preparation: Harvesting of inclusion bodies or membrane fractions, followed by solubilization in detergents (e.g., DDM) .

  3. Purification: Ni<sup>2+</sup>-affinity chromatography and size-exclusion chromatography (SEC) for monodispersity .

MethodApplicationYield
In Vitro ExpressionCell-free systems for rapid productionHigh purity
Baculovirus/Sf9 CellsFor eukaryotic post-translational modifications (rarely used for cyoC)Moderate yield
Bacterial ExpressionCost-effective, scalable; standard for cyoC productionHigh yield

Functional Role in the bo<sub>3</sub> Complex

cyoC interacts with subunits I (cyoB) and IV (cyoD) to form the core of the oxidase. Its structural role includes:

  • Stabilizing Heme Centers: Anchoring heme b and o<sub>3</sub> in subunit I for electron transfer .

  • Proton Translocation: Contributing to the proton-conducting pathway through membrane-spanning helices .

  • Substrate Binding: Facilitating ubiquinol access to the active site via hydrophilic channels .

Inactivation of cyoC disrupts the oxidase complex, impairing aerobic respiration and relieving catabolic repression in E. coli .

Biotechnological Relevance

  • Proton Pump Studies: cyoC is used to probe mechanisms of proton translocation in heme-copper oxidases .

  • Antibiotic Targeting: Mutations in cyoC homologs may inform strategies to disrupt bacterial respiration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will fulfill your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
cyoC; b0430; JW0420; Cytochrome bo(3 ubiquinol oxidase subunit 3; Cytochrome o ubiquinol oxidase subunit 3; Cytochrome o subunit 3; Oxidase bo(3 subunit 3; Ubiquinol oxidase chain C; Ubiquinol oxidase polypeptide III; Ubiquinol oxidase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
cyoC
Target Protein Sequence
MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTG KDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEF HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL SLFWHFLDVVWICVFTVVYLMGAM
Uniprot No.

Target Background

Function
Cytochrome bo(3) ubiquinol terminal oxidase is a component of the aerobic respiratory chain in E. coli, predominating when cells are grown under high aeration conditions. It exhibits proton pump activity across the membrane in addition to electron transfer, pumping 2 protons per electron.
Database Links
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.