Recombinant Escherichia coli Dipeptide transport system permease protein dppB (dppB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Escherichia coli Dipeptide Transport System Permease Protein DppB (DppB)

The recombinant E. coli dipeptide transport system permease protein DppB (UniProt ID: P77308) is a 340-amino-acid transmembrane component of the ABC transporter DppABCDF. It facilitates the transport of dipeptides, tripeptides, and other substrates (e.g., heme, 5-aminolevulinic acid) across the inner membrane in E. coli. Recombinant DppB is typically expressed with an N-terminal His-tag for purification (Source 11).

Structure and Functional Role in the DppABCDF Complex

DppB functions as part of the heterodimeric transmembrane domain (DppB-C) in the DppABCDF transporter. Its structural and functional interactions include:

Cryo-EM Insights

  • Transmembrane Architecture: DppB and DppC form a sealed outward-facing substrate cavity, stabilized by a conserved "scoop motif" in DppB. This motif prevents substrate backflow into the periplasm .

  • Substrate Recognition: DppB interacts with the substrate-bound periplasmic binding protein DppA, enabling ATP-dependent substrate translocation .

Functional Partnerships

ComponentRoleInteraction Strength
DppA (SBP)Binds substrates (dipeptides, heme) in periplasm High (0.999)
DppC (Transmembrane)Forms heterodimer with DppB for channel formation High (0.999)
DppD/DppF (ATPases)Hydrolyze ATP to drive transport High (0.999)

Recombinant Production and Characterization

The recombinant DppB protein is produced via bacterial expression systems (e.g., E. coli BL21). Key production parameters include:

ParameterDetails
Expression VectorpBAD22 or pET-derived plasmids
PurificationNickel affinity chromatography (His-tag)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose

The amino acid sequence of recombinant DppB includes conserved regions critical for substrate translocation and ATPase coupling .

Substrate Specificity

  • Primary Substrates: Dipeptides (e.g., GL), tripeptides, and tetrapeptides .

  • Heme Transport: DppB enables heme uptake when paired with periplasmic binding proteins (e.g., DppA, MppA) .

  • Toxin Uptake: Phaseolotoxin (a tripeptide toxin) is transported via DppBCDF in Pseudomonas aeruginosa, suggesting potential roles in pathogenicity .

Virulence and Pathogenicity

  • Helicobacter pylori: DppB mutants show altered virulence factor expression (e.g., upregulated BabA, HopZ) and enhanced NF-κB activation in host cells .

  • E. coli: DppB is essential for growth under peptide-rich conditions but not under standard LB broth .

Antibiotic Targeting

  • Peptide Mimetics: Designing compounds that exploit DppB’s substrate-binding pockets for targeted delivery .

  • Heme Acquisition Inhibition: Disrupting DppB-mediated heme transport in pathogens lacking dedicated heme permeases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we are happy to accommodate your specific format preferences. Kindly include your requirement in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary based on the purchase method and location. Please contact your local distributor for accurate delivery timelines.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial before opening to gather the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
dppB; b3543; JW3512; Dipeptide transport system permease protein DppB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
dppB
Target Protein Sequence
MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGISPERHAQLLAELGLDK PMWQQYLHYIWGVMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVL AAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMVFLDDSNP LTGFMLIDTAIWGEDGNFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTA RAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQR RDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIRHKK
Uniprot No.

Target Background

Function
This protein, a component of the ABC transporter DppABCDF, is involved in dipeptide transport. It is responsible for the translocation of the substrate across the membrane (Probable). Notably, when a foreign outer membrane heme receptor is expressed in E.coli, DppABCDF can also transport heme and its precursor, 5-aminolevulinic acid (ALA), from the periplasm into the cytoplasm.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of DppB in the dipeptide transport system?

Methodology for structural determination: The structure of DppB as part of the DppBCDF complex can be determined using cryo-electron microscopy (cryo-EM). Sample preparation typically involves purifying the recombinant complex to homogeneity and using a buffer containing 0.006% glyco-diosgenin (GDN) for sample freezing. Advanced image processing techniques allow resolution of most protein residues, although highly flexible regions like the periplasmic scoop motif may require additional techniques for complete structural elucidation .

What is the functional importance of the DppB scoop motif?

The periplasmic scoop motif in DppB plays a critical role in ensuring efficient dipeptide substrate import across the bacterial membrane. Structural and functional studies suggest that this motif acts as a molecular door that seals the outward-facing substrate cavity during transport. This function prevents dipeptides from escaping back into the periplasm after being released from the substrate-binding protein DppA .

Experimental validation approach: The functional significance of the scoop motif can be assessed through bacterial complementation assays. For example, researchers have constructed dppABCDF-deleted (Δdpp) E. coli strains and tested their growth on media supplemented with dipeptides such as glycine-leucine (GL). Strains expressing wild-type DppB can efficiently transport these dipeptides, which at high concentrations (e.g., 0.15 mM) can inhibit bacterial growth. Comparison of growth patterns between wild-type and scoop motif-deleted or mutated DppB variants allows assessment of transport efficiency. Additionally, in vitro ATPase activity assays can quantify the functional impact of scoop motif modifications .

How does DppB interact with other components of the DppABCDF transporter?

DppB interacts extensively with multiple components of the DppABCDF transporter to facilitate dipeptide import. Within the membrane-embedded region, DppB forms direct contacts with DppC to create the translocation pathway. The cytoplasmic region of DppB contains a coupling helix (also known as the EAA motif) that connects TM4 with TM5 and mediates interactions with the nucleotide-binding domain DppD. On the periplasmic side, the scoop motif of DppB forms specific interactions with the substrate-binding protein DppA when the transporter is in the outward-facing conformation .

Analysis techniques: Protein-protein interactions within the DppABCDF complex can be mapped using a combination of structural approaches (cryo-EM, X-ray crystallography) and biochemical methods such as cross-linking coupled with mass spectrometry. Site-directed mutagenesis of residues at predicted interfaces, followed by pull-down assays, can validate key interaction sites. Förster Resonance Energy Transfer (FRET) using fluorescently labeled components can also provide insights into the dynamics of these interactions during the transport cycle .

What expression systems are effective for producing recombinant DppB protein?

Methodological approach: For laboratory-scale expression, DppB can be expressed in E. coli host strains optimized for membrane protein production, such as C41(DE3) or C43(DE3). Expression constructs typically include affinity tags (His, FLAG, etc.) for purification purposes. Expression can be induced using IPTG-inducible promoters, with expression conditions optimized to balance protein yield and proper folding (lower temperatures of 18-25°C and extended induction times often yield better results). For purification, detergent solubilization (using mild detergents like DDM, LMNG, or GDN) followed by affinity chromatography and size exclusion chromatography provides functionally active protein. When co-expressing multiple components, dual-expression vectors or compatible plasmids with different antibiotic resistance markers can be employed, similar to the approach used for other multi-component bacterial systems .

How do conformational changes in DppB contribute to the dipeptide transport mechanism?

The DppB protein undergoes significant conformational changes during the transport cycle, which are essential for dipeptide translocation across the membrane. In the resting state, DppBCDF adopts an inward-facing conformation with the periplasmic side sealed and the cytoplasmic side open. Upon binding of the substrate-loaded DppA protein and ATP, the transporter transitions to an outward-facing conformation. During this transition, the TM helices of DppB rearrange to create a pathway for substrate entry from DppA, with the scoop motif playing a crucial role in this process .

Research methodology: To investigate these conformational changes, researchers utilize a combination of structural approaches capturing different states of the transport cycle. Cryo-EM structures of DppBCDF in various conditions (apo, ATP analog-bound) and the complete DppABCDF complex provide snapshots of distinct conformational states. Computational methods such as molecular dynamics simulations can model intermediate states and energy landscapes of the conformational transitions. Site-specific cross-linking experiments, where pairs of residues predicted to move relative to each other during transport are mutated to cysteines, can validate the predicted conformational changes in vitro and in vivo .

What are the molecular determinants of substrate specificity in the DppB-containing transport system?

While the DppABCDF system primarily transports dipeptides, it also shows limited capacity to transport tri- and tetrapeptides. The molecular basis for this substrate selectivity involves multiple components of the transporter, with DppB playing a significant role in the process.

Experimental approach: To investigate substrate specificity determinants, researchers can employ a systematic mutagenesis strategy targeting the transmembrane regions and periplasmic domains of DppB that line the substrate translocation pathway. Key residues can be identified by aligning DppB sequences across species and with related transporters of different specificities. Functional assays measuring transport of different peptides (varying in size, charge, and hydrophobicity) can be performed using either radioactively labeled substrates or competition assays with toxic peptides like glycine-leucine. X-ray crystallography or cryo-EM studies of the transporter with bound substrate analogs can directly visualize substrate-protein interactions. Complementary approaches include computational docking and molecular dynamics simulations to predict binding modes of different peptide substrates .

How does ATP binding and hydrolysis coordinate with DppB conformational changes during transport?

The transport cycle of the DppABCDF system involves precise coordination between ATP binding/hydrolysis at the nucleotide-binding domains (DppD and DppF) and conformational changes in the transmembrane domains (DppB and DppC). Interestingly, the DppBCDF translocator alone does not hydrolyze ATP, and its activation requires the presence of the substrate-binding protein DppA .

Methodological framework: To study this coordination, researchers can employ ATP hydrolysis assays with purified components under various conditions. The table below summarizes ATPase activity findings from a representative study:

Protein ComponentsSubstrate ConditionRelative ATPase Activity (%)
DppBCDFNo substrate<5%
DppBCDF + DppANo substrate100%
DppBCDF + DppAWith dipeptide145%
DppBCDF (scoop motif deleted) + DppAWith dipeptide60%
DppABCDFWith ATP analogues (ATPγS)Outward-facing conformation observed

Vanadate-trapping experiments can capture transition-state complexes, helping elucidate the sequence of events during ATP hydrolysis and conformational change. Real-time monitoring of conformational changes using techniques like single-molecule FRET, combined with controlled ATP addition, can directly correlate nucleotide states with structural rearrangements in DppB and other components .

What role does the [4Fe-4S] cluster in the DppBCDF complex play in transport function?

Structural studies have identified a [4Fe-4S] cluster at the C-terminus of each ATPase subunit (DppD and DppF) in the E. coli DppBCDF translocator. This is a distinctive feature that differentiates it from homologous transporters in other bacteria like Mycobacterium tuberculosis .

Research strategy: To investigate the functional significance of these [4Fe-4S] clusters, researchers can employ site-directed mutagenesis of coordinating cysteine residues to disrupt cluster formation. The impact on transporter assembly, stability, and function can be assessed through multiple approaches. UV-visible and EPR spectroscopy can confirm the presence or absence of the cluster in purified variants. Transport assays comparing wild-type and cluster-disrupted variants can establish functional importance. Thermal stability assays can determine if the cluster primarily plays a structural role. Redox cycling experiments can test whether the cluster participates in electron transfer during transport, potentially linking peptide transport to the cellular redox state .

How can synthetic biology approaches improve recombinant DppB expression and functional analysis?

Advanced synthetic biology techniques offer promising avenues for enhancing the expression, purification, and functional characterization of complex membrane proteins like DppB.

Implementation methodology: Researchers can employ codon optimization specific to expression hosts to improve translation efficiency. Fusion partners that enhance membrane insertion and folding (such as GFP, Mistic, or MBP) can be strategically incorporated with cleavable linkers. For enhanced oxygen availability in high-density cultures, co-expression of the Vitreoscilla hemoglobin gene (vgb) has been shown to increase biomass and recombinant protein production by over 100% in similar systems . Inducible promoter systems with fine-tuned expression control can prevent toxicity from membrane protein overexpression. Cell-free expression systems using purified components offer an alternative approach that bypasses cellular toxicity issues. For functional analysis, reconstitution into nanodiscs or proteoliposomes creates a native-like membrane environment for transport assays .

What is the proposed mechanism for dipeptide transport through the DppABCDF system?

Based on current structural and biochemical evidence, a comprehensive model of dipeptide transport through the DppABCDF system has been proposed:

  • In the resting state, DppBCDF adopts an inward-facing conformation with the periplasmic side sealed and the cytoplasmic side open.

  • DppA captures dipeptide substrates in the periplasm and docks onto the DppBCDF complex.

  • This interaction, along with ATP binding to both DppD and DppF, triggers a conformational change to an outward-facing state, where the substrate is released from DppA into a sealed cavity formed by DppB and DppC.

  • The scoop motif of DppB prevents substrate escape back to the periplasm.

  • ATP hydrolysis provides energy for returning to the inward-facing conformation, releasing the dipeptide into the cytoplasm.

  • ADP release resets the system for the next transport cycle .

Experimental validation: This mechanistic model can be tested through a combination of approaches. Structure determination of additional intermediate states can provide further snapshots of the transport cycle. Single-molecule FRET studies can track real-time conformational changes during transport. Liposome reconstitution assays with purified components can directly measure transport rates and substrate accumulation. Substrate protection assays, where accessibility of specific residues to chemical modification is monitored during different stages of transport, can map substrate pathways through the protein .

What are the best methods for studying DppB-DppA interactions during the transport cycle?

Understanding the dynamic interactions between DppB and the substrate-binding protein DppA is crucial for elucidating the complete transport mechanism. Several complementary approaches can be employed to capture and characterize these interactions at different stages of the transport process.

Methodological workflow:

  • Structural studies: Cryo-EM of the complete DppABCDF complex in the presence of ATP analogs like ATPγS can capture the outward-facing conformation where DppA interacts with DppB's scoop motif .

  • Interaction mapping: Chemical cross-linking coupled with mass spectrometry (XL-MS) can identify specific residues involved in the DppA-DppB interface. This approach is particularly valuable for capturing transient interactions during the transport cycle.

  • Mutagenesis validation: Based on structural and XL-MS data, systematic alanine scanning mutagenesis of the identified interface residues can confirm their functional importance through transport assays.

  • Real-time interaction monitoring: Surface plasmon resonance (SPR) or biolayer interferometry (BLI) with immobilized DppBCDF can measure binding kinetics of wild-type and mutant DppA variants under different nucleotide conditions.

  • In vivo validation: Bacterial two-hybrid assays or FRET-based approaches using fluorescently labeled components can verify interactions in a cellular context .

How can computational approaches enhance our understanding of DppB function?

Computational methods provide powerful tools for exploring aspects of DppB function that are challenging to address experimentally, particularly related to dynamics and energetics of the transport process.

Implementation strategy:

  • Molecular dynamics simulations: Starting from cryo-EM structures, all-atom MD simulations in explicit membrane environments can reveal conformational dynamics of DppB, particularly flexible regions like the scoop motif. Extended simulations (>1 μs) can potentially capture spontaneous conformational transitions.

  • Free energy calculations: Methods like umbrella sampling or metadynamics can estimate energy barriers between different conformational states or determine binding free energies of dipeptide substrates.

  • Coevolution analysis: Statistical coupling analysis of multiple sequence alignments can identify co-evolving residue networks in DppB that may be functionally important for allosteric communication.

  • Homology modeling: For studying species variations, homology models of DppB from different bacteria can be constructed based on the E. coli structure and analyzed for species-specific functional adaptations.

  • Machine learning approaches: Deep learning methods trained on existing transporter structures can help predict effects of mutations or identify potential allosteric communication pathways within the DppB-containing complex .

What are the prospects for using the DppABCDF system in synthetic biology applications?

The detailed understanding of the DppABCDF transport system opens possibilities for various synthetic biology applications, particularly in the areas of peptide-based therapeutics delivery, biosensing, and metabolic engineering.

Research roadmap:

  • Engineered substrate specificity: Site-directed mutagenesis of the substrate binding pocket in DppA and the translocation pathway in DppB/DppC could create variants capable of transporting non-natural peptides or peptide-based drugs.

  • Biosensor development: The DppABCDF system could be engineered as a biosensor for specific peptides by coupling transport activity to reporter gene expression, potentially useful for detecting bioactive peptides or environmental contaminants.

  • Metabolic engineering: Integration of modified DppABCDF systems into production strains could enhance uptake of specific peptide precursors for biosynthetic pathways, potentially improving yields of recombinant proteins or biopharmaceuticals.

  • Chimeric transporters: Creating chimeric proteins combining DppB with components from other ABC transporters might generate systems with novel substrate specificities or improved transport efficiencies .

How does the DppB protein compare to homologous proteins in other bacterial species?

Comparative analysis of DppB across bacterial species can provide insights into evolutionary conservation, species-specific adaptations, and potential targets for selective inhibition.

Analytical framework:

The DppB protein in E. coli shows both conserved features and notable differences compared to homologs in other bacteria. Unlike the heterotrimeric Mycobacterium tuberculosis DppBCD translocator, the E. coli DppBCDF translocator is a heterotetramer. The presence of [4Fe-4S] clusters in the E. coli complex is another distinctive feature not observed in all homologs .

Structure-based sequence alignment of DppB from diverse bacterial species reveals that while the transmembrane topology and key functional residues are generally conserved, the periplasmic domains show considerable variation. This suggests species-specific adaptations potentially related to different substrate preferences or environmental niches.

In pathogenic bacteria, the Dpp transport system often plays roles beyond basic nutrition, including contribution to virulence, antibiotic resistance, or host colonization. Understanding these species-specific functions could inform targeted therapeutic approaches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.