Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Electron Transport Complex Protein RnfE (rnfE)

Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE) is a transmembrane component of the Rnf complex, a Na⁺-translocating ferredoxin:NAD⁺ oxidoreductase system critical for energy coupling in bacterial electron transport chains . Originally identified in Rhodobacter capsulatus, the Rnf complex (RnfABCDGEH) facilitates redox-driven ion transport, enabling energy generation under anaerobic conditions . In E. coli, RnfE (UniProt: B1LEQ4) corresponds to the YdgQ homolog, with structural and functional roles distinct from other Rnf subunits .

Functional Role in the Rnf Complex

RnfE is integral to the Rnf complex’s electron transport and ion translocation mechanisms. While RnfC contains NAD⁺-binding and Fe-S cluster domains , RnfE’s transmembrane orientation facilitates:

  1. Subunit Assembly: Stabilizes interactions between RnfA, RnfB, and RnfC, preventing degradation .

  2. Ion Transport: Contributes to the Na⁺ translocation driven by ferredoxin:NAD⁺ redox activity .

  3. Redox Coupling: Enables electron transfer from ferredoxin to NAD⁺, generating a proton motive force .

RnfE’s absence destabilizes the entire complex, as observed in R. capsulatus mutants lacking RnfA or RnfB .

Recombinant Production Challenges and Strategies

Recombinant RnfE production in E. coli faces hurdles due to its hydrophobicity and membrane localization. Key findings include:

ChallengeSolutionOutcomeSource
Low SolubilityUse of His-tagged constructs and optimized E. coli strains (e.g., BL21)Partial recovery of soluble protein
InstabilityCo-expression with stabilizing chaperones (e.g., RnfA, RnfB)Enhanced complex stability
Strain DependencyUse of EAEC strain 55989 or SMS-3-5 for improved secretionSuccessful recombinant production

Notably, RnfE was expressed as a His-tagged recombinant protein in E. coli, though yields remain lower than soluble cytoplasmic proteins due to aggregation risks .

Research Applications and Implications

RnfE serves as a model for studying membrane protein biogenesis and bioenergetic pathways. Applications include:

  • Vaccine Development: Recombinant RnfE (strain 55989/EAEC) is used in research for pathogenic E. coli strain studies .

  • Bioenergetic Research: Insights into RnfE’s topology inform engineering of Na⁺-dependent electron transport systems .

  • Protein Engineering: Directed evolution approaches (e.g., N-terminal sequence optimization) improve yields, though results are protein-specific .

Comparative Analysis with Other Rnf Subunits

SubunitTopologyStabilityKey Features
RnfAN-out-C-outRequires RnfE for stabilitySix TM domains; interacts with RnfB
RnfBHydrophilicStabilized by RnfAContains [2Fe-2S] cluster
RnfCSolubleUnstable without RnfEContains NAD⁺-binding domain
RnfEN-in-C-inCritical for complex assemblySix TM domains; no prosthetic groups

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipment, please contact us in advance as additional fees apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
rsxE; ECDH10B_1766; Ion-translocating oxidoreductase complex subunit E; Rsx electron transport complex subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Escherichia coli (strain K12 / DH10B)
Target Names
rsxE
Target Protein Sequence
MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEAAAERALPNGETGNV
Uniprot No.

Target Background

Function
RnfE is a component of a membrane-bound complex that couples electron transfer with the translocation of ions across the membrane. It plays a crucial role in maintaining the reduced state of SoxR.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Electron Transport Complex Protein RnfE in E. coli?

The Electron Transport Complex Protein RnfE is a component of the Rnf complex in Escherichia coli, which participates in electron transport and energy conservation. The Rnf complex is involved in the electron transport chain (ETC), which is central to respiration and ATP production. In E. coli, the ETC is highly flexible, consisting of multiple dehydrogenases and reductases that allow growth in both oxic and anoxic environments . The expression of these enzymes, including components of complexes like RnfE, is regulated by various electron acceptors following a known hierarchy, with oxygen repressing anoxic respiratory pathways .

How is the expression of electron transport components like RnfE regulated in E. coli?

Expression of electron transport components in E. coli, including proteins like RnfE, is regulated by transcription factors such as ArcA and FNR, which respond to oxygen availability. According to research, ArcA activity is repressed by oxidized quinones (ubiquinones, menaquinones, and demethylmenaquinones) and activated by reduced quinones . This regulation mechanism involves redox reactions between quinones and regulatory proteins. For example, oxidized ubiquinones bind to the ArcBA system, leading to deactivation of the transcription factor, while reduced quinones reactivate it . FNR is another transcription factor that regulates ETC enzymes, with both factors forming a regulatory network that adjusts the expression of electron transport components based on oxygen availability .

What experimental designs are most effective for studying recombinant RnfE in E. coli?

For studying recombinant RnfE in E. coli, a structured experimental approach involving controlled manipulation of variables is essential. Based on experimental design principles, the following methodology would be effective:

  • Independent Variables: Manipulate factors such as:

    • Oxygen availability (aerobic vs. anaerobic conditions)

    • Carbon source types and concentrations

    • Expression levels of RnfE (using inducible promoters)

    • Genetic background (wild-type vs. mutant strains)

  • Dependent Variables: Measure outcomes including:

    • Growth rate and biomass yield

    • ATP production rates

    • Proton-pumping efficiency

    • Redox state of the quinone pool

    • Expression levels of related genes

  • Controlling Extraneous Variables: Maintain constant temperature, pH, media composition, and culture conditions to isolate the effects of the independent variables .

  • Randomization: Apply proper randomization to experimental units to minimize systematic bias in the results .

This approach allows for rigorous testing of hypotheses related to RnfE function and regulation, establishing cause-and-effect relationships between manipulated variables and observed outcomes.

How can I design experiments to study the interaction between RnfE and other components of the electron transport chain?

To study interactions between RnfE and other electron transport chain components, a multilayered experimental design approach is recommended:

  • Genetic Approach:

    • Create knockout mutants of genes encoding RnfE and potential interacting partners

    • Generate strains with tagged versions of RnfE (e.g., His-tag, FLAG-tag) for protein interaction studies

    • Implement CRISPR-Cas9 for precise genetic modifications

  • Biochemical Interaction Studies:

    • Co-immunoprecipitation (Co-IP) to identify protein-protein interactions

    • Bacterial two-hybrid system to confirm direct interactions

    • Blue native PAGE to analyze intact protein complexes

  • Functional Assays:

    • Measure electron transfer rates with different combinations of components

    • Assess proton pumping using pH-sensitive fluorescent probes

    • Quantify ATP production under various conditions

  • Experimental Design Structure:

    • Use factorial designs to test multiple factors simultaneously

    • Implement response surface methodology to optimize conditions

    • Include appropriate controls for each experimental condition

This comprehensive approach provides insights into both physical interactions and functional relationships between RnfE and other electron transport chain components.

What are the key considerations when designing a laboratory evolution experiment for E. coli strains with modified RnfE?

Designing laboratory evolution experiments for E. coli strains with modified RnfE requires careful consideration of several factors:

  • Selection Pressure Design:

    • Define clear selective conditions that target RnfE function

    • Consider using conditions where RnfE function would provide a growth advantage

    • Implement gradually increasing selection pressure to allow adaptation

  • Evolution Parameters:

    • Determine appropriate population sizes to balance genetic drift and selection

    • Establish transfer schedules (serial transfer vs. continuous culture)

    • Define the duration of the evolution experiment (number of generations)

  • Monitoring and Analysis:

    • Implement regular phenotypic assessments (growth rate, metabolic profiles)

    • Conduct periodic genotypic analysis (whole-genome sequencing)

    • Track evolutionary trajectories of multiple replicate populations

  • Controls and Validation:

    • Include wild-type controls evolved under identical conditions

    • Maintain frozen stocks at regular intervals for retrospective analysis

    • Validate evolved traits through reconstruction of individual mutations

Laboratory evolution has successfully been used to study synthetic electron transport system variants in E. coli, allowing strains with unbranched ETS that pump different numbers of protons per electron to evolve to optimized growth rates . This approach could be applied to study RnfE modifications and their impact on electron transport efficiency.

How does the recombination frequency in pathogenic E. coli strains affect the genetic stability of recombinant RnfE constructs?

The recombination frequency in pathogenic E. coli strains has significant implications for the genetic stability of recombinant constructs, including those containing RnfE. Research has shown that extraintestinal pathogenic E. coli (ExPEC) isolates display strikingly higher recombination rates than commensal strains, with recombinant frequencies ranging across 9 orders of magnitude . This elevated recombination capacity in pathogenic strains is positively associated with the presence of virulence factors .

For recombinant RnfE constructs, this has several implications:

  • Genetic Instability Risk: Higher recombination rates may lead to:

    • Increased likelihood of homologous recombination with chromosomal DNA

    • Greater frequency of plasmid rearrangements

    • Potential loss of recombinant sequences over multiple generations

  • Strain Selection Considerations: When choosing E. coli strains for recombinant RnfE expression:

    • Commensal strains may provide better genetic stability

    • ExPEC-derived laboratory strains might require additional measures to ensure construct stability

    • Environmental conditions like growth in urine profoundly affect recombination frequencies in ExPEC strains

  • Monitoring Strategies: For long-term experiments or production:

    • Regular sequence verification of the RnfE construct

    • Assessment of genetic stability over multiple generations

    • Implementation of selection pressure to maintain the recombinant construct

This understanding of strain-specific recombination frequencies provides valuable guidance for experimental design when working with recombinant RnfE in different E. coli genetic backgrounds.

How can I analyze contradictions in published data regarding RnfE function in electron transport?

Analyzing contradictions in published data regarding RnfE function requires a systematic approach to identify, evaluate, and resolve discrepancies:

  • Systematic Contradiction Identification:

    • Create a comprehensive database of RnfE-related findings

    • Categorize claims about function, regulation, and interactions

    • Flag directly opposing claims for in-depth analysis

  • Context-Dependent Evaluation:

    • Assess experimental conditions (e.g., aerobic vs. anaerobic)

    • Consider strain differences (laboratory vs. clinical isolates)

    • Evaluate methodological approaches and their limitations

  • Methodological Resolution Approach:

    • Design experiments specifically targeting contradictory claims

    • Implement multiple complementary techniques to address each question

    • Control for strain-specific and condition-specific variables

  • Statistical and Computational Analysis:

    • Apply meta-analysis techniques to quantitatively assess conflicting results

    • Use computational modeling to test whether contradictory findings can be reconciled within a unified framework

    • Implement contradiction detection algorithms to systematically analyze literature

Clinical contradiction detection approaches used in medical literature can be adapted for resolving contradictions in RnfE functional data . For example, contradictory findings might require deeper context to detect, such as understanding that certain changes in electron transport are positive in some contexts but negative in others, analogous to how clinical contradiction detection requires understanding the context of medical outcomes .

What computational models best represent the role of RnfE in the E. coli electron transport system?

Computational modeling of RnfE in the E. coli electron transport system requires sophisticated approaches that capture the complexity of electron flow and energy transduction:

  • Kinetic Models:

    • Differential equation-based models capturing electron transfer rates

    • Parameters derived from experimental measurements of RnfE activity

    • Integration with existing models of electron transport components

  • Whole-Cell Metabolic Models:

    • Incorporation of RnfE into genome-scale metabolic models

    • Flux balance analysis to predict metabolic outcomes of RnfE modifications

    • Integration of proteome allocation constraints to account for energy limitations

  • Multi-Scale Modeling Approach:

    • Molecular dynamics simulations of RnfE structure and interactions

    • Mesoscale models of protein complex assembly and membrane integration

    • Cell-scale models connecting electron transport to growth and adaptation

  • Model Validation and Refinement:

    • Experimental validation using targeted measurements of model predictions

    • Iterative refinement based on laboratory evolution outcomes

    • Sensitivity analysis to identify key parameters influencing system behavior

Existing models of the E. coli electron transport chain include components such as the Aero-Type System (ATS), which generalizes aerobic bioenergetics and describes respiratory plasticity . These models incorporate relationships between dehydrogenases, quinones, terminal oxidases, and regulatory systems like ArcA and FNR . A comprehensive model for RnfE would need to account for its specific role within this network and how it contributes to proton translocation and energy conservation.

What are the most effective methods for expressing and purifying recombinant RnfE protein from E. coli?

For optimal expression and purification of recombinant RnfE protein from E. coli, the following methodological approach is recommended:

  • Expression System Design:

    • Vector Selection: Use pET-based vectors with T7 promoter for high-level expression

    • Affinity Tags: Incorporate His6-tag or Strep-tag for efficient purification

    • Fusion Partners: Consider MBP (maltose-binding protein) fusion to enhance solubility

    • Strain Selection: BL21(DE3) derivatives with reduced proteolytic activity

  • Optimization of Expression Conditions:

    • Temperature: Lower temperature (16-25°C) often improves membrane protein folding

    • Induction: Use IPTG concentration gradients to identify optimal induction levels

    • Media Composition: Terrific Broth or auto-induction media for higher yields

    • Growth Phase: Induction at mid-log phase (OD600 ~0.6-0.8)

  • Membrane Protein Extraction:

    • Cell Lysis: Gentle disruption via sonication or pressure homogenization

    • Detergent Selection: Test multiple detergents (DDM, LMNG, C12E8) for optimal extraction

    • Solubilization Buffer: Include glycerol and reducing agents to stabilize the protein

  • Purification Strategy:

    • IMAC: Initial capture via immobilized metal affinity chromatography

    • Size Exclusion: Remove aggregates and achieve buffer exchange

    • Ion Exchange: Optional step for removing contaminants

    • Quality Control: Assess purity by SDS-PAGE and Western blotting

This methodology should be optimized specifically for RnfE, which as a membrane-associated electron transport protein, requires careful handling to maintain structure and function throughout the purification process.

How can I measure the electron transport activity of RnfE in vitro and in vivo?

Measuring electron transport activity of RnfE requires complementary in vitro and in vivo approaches:

  • In Vitro Activity Assays:

    • Spectrophotometric Assays:

      • Monitor reduction/oxidation of artificial electron acceptors (e.g., ferricyanide)

      • Track NAD+/NADH or NADP+/NADPH conversion at 340 nm

      • Use specific dyes that change color upon electron transfer

    • Oxygen Consumption Measurements:

      • Clark-type electrode to measure oxygen uptake rates

      • High-resolution respirometry for detailed kinetic analysis

      • Inclusion of specific inhibitors to isolate RnfE contribution

    • Reconstituted Systems:

      • Incorporate purified RnfE into proteoliposomes

      • Measure proton pumping using pH-sensitive fluorescent probes

      • Assess membrane potential generation with voltage-sensitive dyes

  • In Vivo Activity Measurements:

    • Growth-Based Assays:

      • Compare growth rates of wild-type and rnfE mutant strains

      • Test complementation with modified RnfE variants

      • Evaluate growth under different electron donor/acceptor conditions

    • Real-Time Monitoring:

      • Use fluorescent redox sensors to track electron flow in living cells

      • Implement biosensors responding to membrane potential changes

      • Apply microfluidics for single-cell resolution measurements

    • Metabolic Flux Analysis:

      • 13C-labeling to trace carbon flow through metabolic pathways

      • Measure fermentation product profiles as indicators of redox balance

      • Quantify ATP production as a measure of energy conservation efficiency

These methodologies provide complementary data on RnfE activity, from isolated biochemical function to integrated cellular effects, allowing comprehensive characterization of its role in electron transport.

What techniques can be used to study the interaction between RnfE and quinones in the electron transport chain?

Studying the interaction between RnfE and quinones in the electron transport chain requires specialized techniques that can capture both binding events and electron transfer processes:

  • Binding Interaction Analysis:

    • Isothermal Titration Calorimetry (ITC):

      • Directly measure thermodynamic parameters of quinone binding to RnfE

      • Determine binding affinity (Kd), stoichiometry, and energy changes

      • Compare different quinone types (ubiquinone, menaquinone, demethylmenaquinone)

    • Surface Plasmon Resonance (SPR):

      • Real-time monitoring of quinone-RnfE interactions

      • Measure association and dissociation kinetics

      • Screen multiple quinone derivatives efficiently

    • Fluorescence-Based Techniques:

      • Intrinsic tryptophan fluorescence quenching upon quinone binding

      • FRET-based assays with labeled quinones and RnfE

      • Microscale thermophoresis for binding in near-native conditions

  • Electron Transfer Measurements:

    • Fast Kinetics Methods:

      • Stopped-flow spectroscopy to capture rapid electron transfer events

      • Flash photolysis to initiate and monitor electron transfer reactions

      • Freeze-quench EPR to trap intermediate states

    • Electrochemical Approaches:

      • Protein film voltammetry to measure direct electron transfer

      • Cyclic voltammetry to determine redox potentials

      • Chronoamperometry to assess electron transfer rates

  • Structural Approaches:

    • Site-Directed Mutagenesis:

      • Systematic modification of potential quinone-binding residues

      • Activity assays with mutant proteins to identify essential interactions

      • Rescue experiments with modified quinones

    • Computational Docking:

      • In silico modeling of RnfE-quinone interactions

      • Molecular dynamics simulations of binding events

      • Quantum mechanical calculations of electron transfer pathways

Research has shown that oxidized and reduced quinones play crucial roles in regulating electron transport chain components through interactions with regulatory systems like ArcBA . Similar techniques can be applied to understand how quinones interact with RnfE as part of the electron transport process.

How does the plasticity of E. coli's electron transport system affect research on RnfE function?

The plasticity of E. coli's electron transport system has profound implications for research on RnfE function:

  • Adaptive Functional Context:

    • E. coli's ETS demonstrates remarkable adaptability, with laboratory evolution studies showing that even synthetic ETS variants with different proton-pumping efficiencies can evolve to similar optimized growth rates

    • This adaptability means that RnfE function must be studied within the context of this plastic system, recognizing that the bacterium can rewire energy-generating pathways to optimize ATP production

    • Research approaches must account for compensatory mechanisms that may mask RnfE phenotypes

  • Condition-Dependent Expression Patterns:

    • E. coli expresses different ETS components under varying conditions, with RNA-seq data showing a spectrum of expression values across experimental conditions

    • RnfE research must consider this condition-dependent expression, as its function may vary based on the presence of other ETS components

    • Experimental designs should include multiple growth conditions to capture the full spectrum of RnfE activity

  • Regulatory Network Integration:

    • The ETS is regulated by transcription factors like ArcA and FNR, which respond to oxygen availability and the redox state of quinones

    • Understanding RnfE function requires considering its position within this regulatory network

    • Research should examine how global regulators affect RnfE expression and activity under different conditions

  • Methodological Implications:

    • The plasticity of the ETS necessitates multi-faceted experimental approaches

    • Single-gene knockout studies may be insufficient due to compensatory mechanisms

    • System-level approaches combining genetic, biochemical, and computational methods are essential

This understanding of ETS plasticity has led to the concept of an Aero-Type System (ATS), which generalizes aerobic bioenergetics and provides a metabolic systems biology description of respiration and its inherent plasticity . Research on RnfE should be positioned within this broader framework to fully understand its role and significance.

What are the latest research findings on the role of RnfE in adaptation to environmental changes?

Recent research on electron transport systems in E. coli provides insights into how components like RnfE contribute to adaptation to environmental changes:

  • Evolutionary Adaptation Mechanisms:

    • Laboratory evolution studies have shown that E. coli strains with synthetic electron transport systems can evolve to optimize growth rates despite different initial proton-pumping efficiencies

    • These adaptations involve specific rewiring of major energy-generating pathways coupled to the ETS

    • Similar adaptive mechanisms likely involve RnfE when bacteria face environmental changes

  • Oxygen Availability Response:

    • The expression of ETS components is regulated by oxygen availability, with a known hierarchy where oxygen represses anoxic respiratory pathways

    • Regulatory systems including ArcA and FNR adjust the expression of electron transport components in response to oxygen levels

    • RnfE function should be considered within this oxygen-responsive regulatory framework

  • Redox State Adaptation:

    • Quinones play a crucial role in signaling the redox state of the cell, with oxidized quinones repressing ArcA activity and reduced quinones activating it

    • This regulatory mechanism allows the bacterium to adjust its electron transport chain based on the balance between electron donors and acceptors

    • RnfE's interaction with the quinone pool likely contributes to this adaptive response

  • Energy Metabolism Plasticity:

    • E. coli demonstrates remarkable plasticity in energy metabolism, with the ability to modulate ATP production capability through specific pathway rewiring

    • This plasticity enables adaptation to various environmental conditions

    • RnfE, as part of the electron transport system, contributes to this metabolic flexibility

What are the implications of recombination frequency variation in E. coli for genetic engineering of RnfE?

The variation in recombination frequency among E. coli strains has significant implications for genetic engineering of RnfE:

  • Strain Selection Considerations:

    • Extraintestinal pathogenic E. coli (ExPEC) strains display significantly higher recombination rates than commensal strains, with frequencies ranging across 9 orders of magnitude

    • This variation suggests that careful strain selection is crucial for genetic engineering of RnfE

    • Commensal strains may provide more stable genetic backgrounds for precise modifications

  • Environmental Impact on Genetic Stability:

    • Recombination frequencies in ExPEC isolates are profoundly affected by growth conditions, such as growth in urine

    • This environmental plasticity in recombination rates means that experimental conditions must be carefully controlled during genetic engineering

    • Stability testing should include relevant environmental conditions to assess construct reliability

  • Virulence Factor Association:

    • The presence of virulence factors is positively associated with higher recombination frequencies

    • This association suggests that laboratory strains derived from pathogenic isolates may retain elevated recombination rates

    • Genetic engineering strategies should account for this potential instability in virulence factor-positive backgrounds

  • Strategic Approaches for RnfE Engineering:

    • Use strains with lower recombination rates for stable genetic constructs

    • Implement selection markers that maintain the engineered construct

    • Consider site-specific recombination systems (e.g., λ Red, Cre-lox) for precise modifications

    • Test the stability of engineered constructs over multiple generations

  • Evolutionary Considerations:

    • Higher recombination rates in pathogens may be the result of selection for increased evolvability

    • This elevated recombination capacity could be harnessed for directed evolution of RnfE

    • Laboratory evolution approaches could leverage this natural variation to evolve RnfE variants with enhanced functions

Understanding these implications allows researchers to make informed decisions when designing genetic engineering strategies for RnfE, balancing the need for genetic stability with the potential benefits of controlled recombination.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.