Recombinant Escherichia coli Electron transport complex protein RnfG (rnfG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rsxG; rnfG; ydgP; b1631; JW1623; Ion-translocating oxidoreductase complex subunit G; Rsx electron transport complex subunit G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
rsxG
Target Protein Sequence
MLKTIRKHGITLALFAAGSTGLTAAINQMTKTTIAEQASLQQKALFDQVLPAERYNNALA QSCYLVTAPELGKGEHRVYIAKQDDKPVAAVLEATAPDGYSGAIQLLVGADFNGTVLGTR VTEHHETPGLGDKIELRLSDWITHFAGKKISGADDAHWAVKKDGGDFDQFTGATITPRAV VNAVKRAGLYAQTLPAQLSQLPACGE
Uniprot No.

Target Background

Function
RnfG is a component of a membrane-bound complex that couples electron transfer with ion translocation across the membrane. It is essential for maintaining the reduced state of SoxR and likely facilitates electron transfer from NAD(P)H to SoxR.
Database Links
Protein Families
RnfG family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the function of RnfG protein in E. coli electron transport complex?

RnfG is a critical component of the Rnf complex in E. coli, which functions as an ion-translocating ferredoxin:NAD+ oxidoreductase. The complex plays a key role in electron transport and energy conservation by coupling the oxidation of reduced ferredoxin with the reduction of NAD+, generating a transmembrane ion gradient for ATP synthesis. This process is particularly important in anaerobic respiration pathways where RnfG contributes to the complex's ability to translocate Na+ or H+ ions across the membrane .

How can I optimize soluble RnfG protein expression in E. coli?

Optimizing soluble RnfG protein expression requires careful consideration of N-terminal sequences and expression conditions. Based on current methodologies, a directed evolution approach using fluorescence-activated cell sorting (FACS) can significantly enhance recombinant protein yields. Begin by creating a DNA library with diversified sequences coding for the N-termini of RnfG protein, then fuse a GFP reporter to the C-terminus of your construct. Use FACS to identify and select cells displaying higher fluorescence, indicating improved protein expression. This systematic workflow has demonstrated up to 30-fold increases in soluble recombinant protein production for various challenging proteins .

What expression vectors are most suitable for RnfG production?

For optimal RnfG expression, consider vectors containing the following features:

  • An inducible promoter (T7 or tac) for controlled expression

  • Fusion tags that enhance solubility (such as thioredoxin A or glutathione S-transferase)

  • A multiple cloning site (MCS) allowing for precise insertion

  • Appropriate antibiotic resistance markers for selection

The choice between natural codons (CN) and optimized codons (CO) can significantly impact expression levels, with construct-specific outcomes requiring empirical testing for RnfG .

How do I troubleshoot poor RnfG protein yield in recombinant systems?

When encountering poor RnfG yield, implement a systematic troubleshooting approach:

Problem AreaInvestigation MethodPotential Solution
Expression levelSDS-PAGE analysis of total cell lysateModify N-terminal coding sequences
Protein solubilityCompare soluble vs. insoluble fractionsAdd solubility tags (TrxA, GST)
Protein stabilityTime-course analysis post-inductionAdjust incubation temperature
Translation efficiencyAnalyze 5' mRNA secondary structureRedesign nucleotides following start codon

The nucleotides immediately following the start codon significantly influence protein expression, but these effects are construct-specific. Creating and screening libraries of diversified N-terminal coding sequences using FACS-based selection can identify optimal variants for RnfG expression .

What experimental design is most appropriate for studying RnfG function in different metabolic conditions?

A factorial experimental design is most appropriate for studying RnfG function across different metabolic conditions. This approach allows simultaneous investigation of multiple variables including oxygen levels, substrate availability, and growth phase.

First, establish a reliable baseline model using wild-type and rnfG knockout strains. Then, implement a 2^k factorial design where k represents the number of factors being tested. For example, a design testing three factors (oxygen availability, carbon source, temperature) at two levels each would require 8 experimental conditions.

For robust results, include:

  • Technical replicates (minimum n=3)

  • Biological replicates (independent cultures, minimum n=3)

  • Appropriate controls for each condition

  • Both genotypic and phenotypic analyses

This approach enables efficient investigation of interaction effects between variables, which is crucial for understanding RnfG's role in different metabolic contexts3.

How can I detect and analyze contradictions in RnfG functional data?

Contradictions in RnfG functional data often arise from multidimensional interdependencies that require systematic analysis. Implement a structured approach using the (α, β, θ) notation system, where α represents the number of interdependent items, β is the number of contradictory dependencies, and θ is the minimal number of required Boolean rules to assess these contradictions .

To effectively analyze contradictions in RnfG functional data:

  • Identify potentially interdependent experimental variables (e.g., expression levels, activity measurements, growth conditions)

  • Formulate specific hypotheses about expected relationships

  • Apply Boolean logic to formalize contradictions

  • Implement systematic data quality assessment

For example, when analyzing RnfG activity across different redox conditions, expression systems, and metabolic states, you might encounter a (4,6,3) contradiction pattern, indicating four interdependent variables with six contradictory relationships that can be assessed using three Boolean rules .

What are the best approaches for studying RnfG protein-protein interactions within the electron transport complex?

For comprehensive analysis of RnfG protein-protein interactions within the electron transport complex, a multi-method approach yields the most reliable results:

  • In vivo crosslinking coupled with mass spectrometry:

    • Treat living E. coli cells with membrane-permeable crosslinkers

    • Isolate complexes via affinity purification

    • Identify interaction partners through LC-MS/MS analysis

  • Bacterial two-hybrid system:

    • Construct fusion proteins with split reporter domains

    • Co-express in reporter strains

    • Quantify interaction strength through reporter activity

  • Surface plasmon resonance (SPR):

    • Immobilize purified RnfG on sensor chip

    • Flow potential interaction partners over the surface

    • Measure association and dissociation kinetics

  • Förster resonance energy transfer (FRET):

    • Generate fusion proteins with appropriate fluorophores

    • Express in living cells

    • Measure energy transfer as indicator of protein proximity

Each method provides complementary information about interaction dynamics, allowing triangulation of results to overcome limitations of individual approaches .

How can qualitative research methods enhance RnfG functional studies?

Qualitative research methods can provide valuable insights into RnfG functional studies by uncovering phenomena that quantitative approaches might miss. Implement purposive sampling strategies to select experimental conditions that reveal rich information about RnfG function under specific metabolic states .

For example, use grounded theory research to develop a theoretical framework explaining RnfG's role in electron transport by:

  • Conducting initial exploratory experiments without rigid hypotheses

  • Collecting diverse data types (expression patterns, activity measurements, growth phenotypes)

  • Using constant comparative analysis to identify emerging patterns

  • Developing and iteratively refining conceptual categories

  • Constructing a theoretical model that explains RnfG's function

This approach is particularly valuable for understanding complex systems where multiple variables interact in ways that aren't easily captured by reductionist quantitative methods alone .

What control strains should be included when studying recombinant RnfG expression?

When studying recombinant RnfG expression, a comprehensive set of control strains is essential for valid interpretation:

Control TypeDescriptionPurpose
Empty vectorHost cells transformed with expression vector lacking rnfGBaseline for host response to expression conditions
Inactive mutantRnfG with site-directed mutations in functional domainsDistinguish activity-dependent from expression-dependent effects
Known expressorE. coli strain expressing a well-characterized protein (e.g., GFP)Positive control for expression system performance
Wild-type RnfGNon-recombinant, native RnfG expressionReference for natural expression levels and activity
rnfG knockoutStrain with rnfG gene deletedNegative control for RnfG-specific effects

Additional controls should address specific experimental variables such as induction conditions, media composition, and growth phase. This systematic approach ensures that observed effects can be confidently attributed to the recombinant RnfG rather than experimental artifacts3.

How should I design experiments to optimize N-terminal sequences for RnfG expression?

Design a systematic approach to optimize N-terminal sequences for RnfG expression through directed evolution and high-throughput screening:

  • Library Construction:

    • Generate a DNA library of diversified N-terminal coding sequences (first 10-15 codons)

    • Maintain the amino acid sequence while varying codon usage

    • Include variations in the region immediately following the start codon

  • Construct Design:

    • Fuse RnfG to a C-terminal GFP reporter

    • Include an appropriate linker sequence to prevent interference with folding

    • Maintain consistent promoter and regulatory elements across all variants

  • Screening Strategy:

    • Transform library into expression host

    • Induce protein expression under standardized conditions

    • Use FACS to sort cells based on fluorescence intensity

    • Collect highest-expressing population (top 1-5%)

  • Validation and Analysis:

    • Sequence selected clones to identify beneficial N-terminal sequences

    • Confirm increased expression through quantitative protein analysis

    • Verify proper folding and activity of the optimized constructs

This approach has demonstrated up to 30-fold increases in soluble protein production for challenging recombinant proteins in E. coli .

What factors should be considered when designing experiments to study RnfG activity in anaerobic conditions?

When designing experiments to study RnfG activity under anaerobic conditions, several critical factors must be carefully controlled:

  • Oxygen Exclusion:

    • Use specialized anaerobic chambers or glove boxes

    • Implement oxygen scavenging systems (e.g., pyrogallol)

    • Monitor oxygen levels with sensitive probes throughout experiments

  • Redox Control:

    • Maintain defined redox potential using appropriate buffers

    • Include redox indicators for visual confirmation

    • Use redox-active compounds at physiologically relevant concentrations

  • Substrate Availability:

    • Ensure consistent availability of electron donors and acceptors

    • Account for potential substrate competition in complex media

    • Consider using defined minimal media with controlled carbon sources

  • Experimental Timeline:

    • Allow sufficient adaptation time for anaerobic metabolism

    • Consider time-resolved measurements to capture transition dynamics

    • Design appropriate sampling intervals based on growth rates

  • Analytical Considerations:

    • Preserve anaerobic conditions during sample processing

    • Select enzyme assays compatible with anaerobic environment

    • Implement rapid quenching methods to capture transient states

Factorial experimental designs enable efficient investigation of how these factors interact to influence RnfG activity, providing a comprehensive understanding of its function in anaerobic electron transport3.

How can I implement a snowball sampling approach to identify novel RnfG interacting partners?

To implement a snowball sampling approach for identifying novel RnfG interacting partners:

  • Initial Identification:

    • Begin with known RnfG interacting proteins (other Rnf complex components)

    • Use affinity purification coupled with mass spectrometry to identify primary interactors

    • Validate these interactions using orthogonal methods (bacterial two-hybrid, co-immunoprecipitation)

  • Expanding the Network:

    • Express and purify each confirmed interacting partner

    • Use these proteins as baits in subsequent interaction screens

    • Identify secondary interactors that may indirectly associate with RnfG

  • Network Analysis:

    • Map all identified interactions using protein interaction network software

    • Calculate network parameters (centrality, betweenness) to identify key nodes

    • Identify clusters of functionally related proteins

  • Functional Validation:

    • Disrupt key interactions through mutagenesis or inhibition

    • Assess functional consequences on electron transport and energy metabolism

    • Correlate network position with functional importance

This snowball sampling approach is particularly valuable for studying stigmatized or hard-to-find participants in traditional research contexts, but can be adapted to protein interaction studies to uncover previously unknown components of the RnfG-associated interactome .

How should contradictions in RnfG functional data be systematically analyzed?

Contradictions in RnfG functional data require a structured analytical approach using the (α, β, θ) notation system:

  • Identification Phase:

    • List all interdependent experimental variables (α)

    • Document all observed contradictory dependencies (β)

    • Develop Boolean rules to assess these contradictions (θ)

  • Analysis Framework:

    • Construct truth tables representing all possible combinations of variables

    • Apply Boolean minimization techniques to identify minimal rule sets

    • Calculate the contradiction complexity index (β/θ ratio)

  • Resolution Strategy:

    • For high β/θ ratios (>2), investigate underlying biological mechanisms

    • For low β/θ ratios (≤1), review experimental procedures for methodological issues

    • Implement a systematic review of literature to identify similar contradiction patterns

For example, when analyzing RnfG activity data, you might encounter a pattern where activity increases under certain redox conditions but decreases under others, despite similar expression levels. This might represent a (3,4,2) contradiction pattern, indicating three interdependent variables with four contradictory observations that can be assessed using two Boolean rules .

What statistical approaches are appropriate for analyzing RnfG expression optimization experiments?

For rigorous analysis of RnfG expression optimization experiments, implement the following statistical approaches:

  • Preliminary Analysis:

    • Assess normality using Shapiro-Wilk test

    • Evaluate homogeneity of variance with Levene's test

    • Identify and address outliers using boxplot analysis

  • Comparative Analysis:

    • For normally distributed data: ANOVA with post-hoc Tukey HSD

    • For non-parametric data: Kruskal-Wallis with Mann-Whitney U pairwise comparisons

    • Include false discovery rate correction for multiple comparisons

  • Multivariate Analysis:

    • Principal Component Analysis (PCA) to identify key factors affecting expression

    • Response surface methodology (RSM) for optimizing multiple parameters

    • Partial least squares (PLS) regression for correlating sequence features with expression

  • Model Validation:

    • K-fold cross-validation to test predictive models

    • Bootstrapping to establish confidence intervals

    • Leave-one-out validation for small sample sizes

When analyzing N-terminal sequence optimization data, these approaches can identify statistically significant patterns and correlations between sequence features and expression levels, guiding further optimization efforts .

How can I effectively integrate qualitative and quantitative data in RnfG research?

Integrating qualitative and quantitative data in RnfG research requires a mixed-methods approach:

  • Sequential Exploratory Design:

    • Begin with qualitative observations of RnfG expression patterns

    • Develop hypotheses based on these observations

    • Test hypotheses with targeted quantitative experiments

    • Interpret quantitative results in light of initial qualitative insights

  • Parallel Convergent Design:

    • Simultaneously collect qualitative observations and quantitative measurements

    • Analyze each dataset independently using appropriate methods

    • Compare and contrast findings to identify convergent and divergent results

    • Develop integrated explanations that account for both data types

  • Data Transformation Techniques:

    • Convert qualitative observations into semi-quantitative scores

    • Develop categorical frameworks for quantitative data

    • Create visual representations that incorporate both data types

  • Interpretive Framework:

    • Establish clear criteria for resolving apparent contradictions

    • Prioritize data based on methodological strength

    • Develop theoretical models that accommodate both data types

This integrated approach leverages the strengths of both methodologies: qualitative methods providing depth and context, while quantitative methods offering precision and generalizability .

What approaches can be used to analyze the impact of RnfG mutations on protein function?

To comprehensively analyze the impact of RnfG mutations on protein function:

  • Structural Impact Analysis:

    • Conduct in silico modeling using homology modeling or ab initio prediction

    • Calculate stability changes (ΔΔG) for each mutation

    • Analyze potential disruption of critical interaction surfaces

    • Predict alterations in dynamic properties through molecular dynamics simulations

  • Functional Characterization:

    • Measure electron transfer rates using spectrophotometric assays

    • Quantify ion translocation efficiency through membrane potential measurements

    • Assess complex assembly via blue native PAGE and co-immunoprecipitation

    • Determine growth phenotypes under relevant metabolic conditions

  • Statistical Analysis Framework:

    • Implement multiple linear regression to correlate structural changes with functional outcomes

    • Use principal component analysis to identify patterns across multiple mutations

    • Apply machine learning algorithms to predict functional impacts of untested mutations

  • Data Visualization and Integration:

    • Generate structure-function correlation maps

    • Develop mutation sensitivity profiles for different functional domains

    • Create integrated datasets linking sequence, structure, and function

This systematic approach enables comprehensive characterization of how specific mutations affect RnfG's role in electron transport and energy conservation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.