Recombinant Escherichia coli Ferredoxin-type protein napH (napH)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Escherichia coli Ferredoxin-type protein NapH (NapH) is a genetically engineered iron-sulfur protein expressed in E. coli for research applications. NapH belongs to the ferredoxin family, which facilitates electron transfer in redox reactions. In E. coli, the napH gene (synonym: yejZ) encodes this protein, which is implicated in nitrate reduction pathways and redox homeostasis .

Expression and Purification

  • Host System: Expressed in E. coli (strain K12) using vectors like p delta blue under bacteriophage lambda promoters .

  • Solubility: Predominantly found in inclusion bodies, with partial solubility in the cytoplasmic fraction .

  • Purity: >90% as confirmed by SDS-PAGE .

ParameterDetails
Gene NamenapH (also yejZ)
UniProt IDP33934 (E. coli strain K12)
Protein Length287 amino acids
TagN-terminal His tag
Expression HostEscherichia coli

Catalytic Activity

  • Electron Transfer: NapH likely participates in electron shuttling, analogous to other ferredoxins, though its specific substrates in E. coli remain under investigation .

  • Interaction Partners: Associates with redox enzymes such as nitrate reductase (Nap complex) .

Research Applications

  • Enzyme Kinetics: Used to study electron transfer mechanisms in bacterial nitrate respiration .

  • Structural Studies: Purified recombinant NapH enables X-ray crystallography and circular dichroism analyses .

  • Oxidative Stress Models: Investigated for roles in redox homeostasis under stress conditions (e.g., methyl viologen exposure) .

Comparative Analysis with Homologs

The Haemophilus influenzae NapH homolog (UniProt ID: P44653) shares 65% sequence identity with E. coli NapH but exhibits distinct biochemical properties, such as altered solubility profiles .

FeatureE. coli NapHH. influenzae NapH
Sequence Identity100%65%
SolubilityPartial in cytoplasmMostly insoluble
TagHis tagHis tag

Challenges and Future Directions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
napH; yejZ; b2204; JW2192; Ferredoxin-type protein NapH; Ubiquinol--[NapC cytochrome c] reductase NapH subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-287
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
napH
Target Protein Sequence
MANRKRDAGREALEKKGWWRSHRWLVLRRLCQFFVLGMFLSGPWFGVWILHGNYSSSLLF DTVPLTDPLMTLQSLASGHLPATVALTGAVIITVLYALAGKRLFCSWVCPLNPITDLANW LRRRFDLNQSATIPRHIRYVLLVVILVGSALTGTLIWEWINPVSLMGRSLVMGFGSGALL ILALFLFDLLVVEHGWCGHICPVGALYGVLGSKGVITVAATDRQKCNRCMDCFHVCPEPH VLRAPVLDEQSPVQVTSRDCMTCGRCVDVCSEDVFTITTRWSSGAKS
Uniprot No.

Target Background

Function
Essential for electron transfer from ubiquinol, via NapC, to the periplasmic nitrate reductase NapAB complex.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.