Recombinant Escherichia coli Flagellar biosynthetic protein flhB (flhB)

Shipped with Ice Packs
In Stock

Description

Role in Flagellar Assembly and Export Switching

FlhB coordinates the transition from rod/hook-type to filament-type protein export during flagellar morphogenesis:

Functional Mechanism

  • Substrate Specificity: FlhB<sup>CC</sup> interacts with FliK (hook-length control protein) to regulate export switching .

  • Autocleavage Requirement: Cleavage at NPTH is essential for functional T3SS. Mutations (e.g., N269A) block processing and impair motility .

  • PRR Impact: Deletion of the PRR reduces filament formation by 60% and hook assembly by 40% in Shewanella putrefaciens, highlighting its role in autocleavage regulation .

Table 1: Key Experimental Insights

Study FocusMethodologyKey ResultOrganismReference
Autocleavage MechanismWestern blot of His/FLAG-tagged FlhB90% of wild-type FlhB is cleaved; N269A abolishes processing.E. coli
Export SpecificityΔ flhB mutant analysisLoss of FlhB prevents flagellar assembly and motility.Listeria monocytogenes
Biotechnological ApplicationΔ flhC strain engineeringReduced flagellar gene expression increased recombinant protein yield by 1.81×.E. coli

Metabolic Engineering Advantages

  • Enhanced Protein Production: Disruption of flagellar regulators (e.g., flhC) redirects cellular energy from flagellar synthesis to recombinant protein production, increasing ATP and NADPH pools .

  • System Optimization: High-copy plasmids restore growth rates in flhC mutants without increasing glucose consumption, enabling scalable fermentation .

Challenges in Recombinant FlhB Production

  • Membrane Localization: Hydrophobic regions complicate soluble expression, requiring specialized expression systems.

  • Autocleavage Dynamics: Incomplete processing (e.g., in PRR-deleted variants) reduces functional efficacy .

Future Directions

  • Structural Engineering: Rational design of FlhB variants with improved cleavage efficiency or altered substrate specificity.

  • Synthetic Biology: Leveraging FlhB-dependent T3SS for targeted delivery of therapeutic proteins.

  • High-Throughput Screening: Identifying small-molecule modulators of FlhB autocleavage for industrial applications.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific requirements for the format, please indicate your preferences in the order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
flhB; yecQ; b1880; JW1869; Flagellar biosynthetic protein FlhB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
flhB
Target Protein Sequence
MSDESDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVSVIWFGGVSLARRLSGML SAGLHFDHSIINDPNLILGQIILLIREAMLALLPLISGVVLVALISPVMLGGLVFSGKSL QPKFSKLNPLPGIKRMFSAQTGAELLKAILKTILVGSVTGFFLWHHWPQMMRLMAESPIT AMGNAMDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKQSEGDPHVK GRIRQMQRAAARRRMMADVPKADVIVNNPTHYSVALQYDENKMSAPKVVAKGAGLVALRI REIGAENNVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQRP VQPTHLPVPEALDFINEKPTHE
Uniprot No.

Target Background

Function
The FlhB protein is essential for the formation of the rod structure within the basal body of the flagellar apparatus. It collaborates with FliI and FliH to form a putative export apparatus for flagellin, a key component of bacterial flagella.
Database Links
Protein Families
Type III secretion exporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is FlhB and what role does it play in bacterial flagellar assembly?

FlhB is a critical component of the flagellar Type III Secretion System (T3SS) in bacteria, including E. coli. It functions as a transport protein involved in the flagellar export system, mediating the secretion of flagellar components during assembly. The protein consists of two major domains: an N-terminal transmembrane domain (TMD) and a cytoplasmic C-terminal domain (FlhB-C) . The TMD participates in the formation of the export gate as part of the FliPQR complex, which controls substrate entry into the secretion channel . As demonstrated in various bacterial species, FlhB plays a crucial role in coordinating flagellar gene expression with assembly, and its absence completely abolishes motility and flagella synthesis . Experimental evidence from L. monocytogenes mutants shows that deletion of flhB prevents flagellin expression and secretion, confirming its essential role in flagellar biogenesis .

How is the autocleavage mechanism of FlhB relevant to its function?

The cytoplasmic domain of FlhB (FlhB-C) undergoes autocleavage at a conserved NP(T/E)H motif, resulting in two tightly associated subdomains: FlhB-CN and FlhB-CC . This autocleavage event is critical for the protein's function in substrate specificity switching during flagellar assembly. Research in Salmonella enterica has demonstrated that mutations of the conserved asparagine (N269) completely inhibit autocleavage, while alterations to the proline (P270) reduce the efficiency of this process . The functional significance of this cleavage is evident in the phenotypic consequences: S. enterica mutants with an alanine substitution at N269 exhibit a "polyhook" phenotype characterized by significantly extended hook structures and the absence of filament formation . This indicates that the autocleavage mechanism is essential for transitioning from hook protein export to flagellin export during flagellar assembly. For researchers studying FlhB function, site-directed mutagenesis of the conserved NPTH motif provides a valuable approach to investigate the relationship between structural changes and functional outcomes in the flagellar export system.

What are the optimal expression systems for recombinant FlhB production in E. coli?

For recombinant FlhB expression in E. coli, the pET expression system has proven particularly effective. Histidine-tagged fusion constructs using vectors such as pET30a(+) allow for efficient expression and subsequent purification of FlhB . When designing expression constructs, researchers should consider several factors:

  • Domain architecture: Given FlhB's transmembrane and cytoplasmic domains, expression of the full-length protein may present challenges. Many studies focus on the cytoplasmic domain (FlhB-C) for structural and functional analyses.

  • Expression conditions: Induction parameters should be optimized to balance protein yield with proper folding. Typical conditions include IPTG induction at concentrations of 0.1-1.0 mM when cultures reach mid-log phase (OD600 0.6-0.8).

  • Host strain selection: E. coli BL21(DE3) and its derivatives are commonly employed for T3SS protein expression due to their reduced protease activity and compatibility with T7 promoter-driven expression systems .

To enhance solubility and reduce inclusion body formation, researchers can employ strategies such as lower induction temperatures (16-25°C), co-expression with chaperones, or fusion with solubility-enhancing tags like MBP or SUMO. The choice between periplasmic or cytoplasmic expression should be guided by the experimental goals and the requirement for proper disulfide bond formation .

What purification strategies yield the highest purity and activity for recombinant FlhB?

Purification of recombinant FlhB typically follows a multi-step approach to achieve high purity while maintaining the protein's native structure and activity:

Purification StepMethodBuffer ConditionsNotes
Initial CaptureIMAC (Ni-NTA)50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20-40 mM imidazoleFor His-tagged FlhB constructs
Intermediate PurificationIon Exchange Chromatography20 mM Tris-HCl pH 8.0, 0-500 mM NaCl gradientSeparates based on charge differences
PolishingSize Exclusion Chromatography20 mM Tris-HCl pH 8.0, 150 mM NaClRemoves aggregates and ensures monodispersity
OptionalAffinity Tag RemovalProtease buffer as per manufacturerUsing TEV or thrombin protease

For membrane-associated full-length FlhB, detergent solubilization is necessary. Mild detergents such as n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) at concentrations just above their critical micelle concentration (CMC) are recommended to maintain protein stability while extracting it from membranes. Throughout purification, researchers should monitor protein activity using functional assays specific to FlhB, such as in vitro autocleavage assays or binding studies with known interaction partners.

How do mutations in the conserved NP(T/E)H motif impact FlhB function in flagellar assembly?

The conserved NP(T/E)H motif in FlhB is critical for its autocleavage and substrate specificity switching functions. Experimental evidence reveals distinct phenotypic consequences of mutations within this motif:

  • N269A mutation (in S. enterica): Completely inhibits autocleavage, resulting in a "polyhook" phenotype characterized by extended hook structures and absence of filament formation. These mutants show defects in flagellin secretion despite normal hook protein export .

  • P270A mutation: Reduces autocleavage efficiency rather than eliminating it completely. This mutation also produces a polyhook phenotype but with some residual flagellin export capability .

  • Mutations in surrounding residues: Alterations to amino acids adjacent to the NPTH motif can modulate autocleavage kinetics and efficiency, providing insights into the structural requirements for this process.

These findings demonstrate that the precise structural conformation of the NPTH region is essential for the substrate specificity switch that occurs after hook completion. For researchers investigating FlhB function, site-directed mutagenesis of this motif offers a powerful approach to correlate structural changes with functional outcomes. When designing such experiments, researchers should consider using complementation assays with flhB deletion strains to verify phenotypic effects, combined with biochemical analyses of autocleavage efficiency using purified protein variants.

What techniques are most effective for studying FlhB interactions with other flagellar proteins?

Understanding FlhB's interactions with other flagellar components requires a combination of in vivo and in vitro approaches:

TechniqueApplicationAdvantagesLimitations
Bacterial Two-HybridInitial screening of protein-protein interactionsHigh-throughput, in vivo contextPotential false positives/negatives
Co-immunoprecipitationVerification of interactions in native contextPreserves physiological complexesRequires specific antibodies
Surface Plasmon ResonanceQuantitative binding kineticsReal-time measurement, label-freeRequires purified proteins
Crosslinking MSIdentification of interaction interfacesMaps contact points at residue levelComplex data analysis
Cryo-EMStructural analysis of protein complexesVisualizes assemblies in near-native stateResolution limitations for dynamic regions

Recent structural studies have revealed that the TMD of FlhB is part of the FliPQR complex, participating in T3SS gating mechanisms . When investigating such interactions, researchers should consider the membrane environment's influence on complex formation and stability. For reconstitution experiments, nanodiscs or liposomes may better preserve the native conformation of membrane-embedded complexes compared to detergent micelles.

How can the flagellar type III secretion system be bioengineered for heterologous protein secretion?

The flagellar T3SS in E. coli presents a promising platform for heterologous protein secretion in biotechnology applications. This approach leverages the natural protein export capacity of approximately 1700 flagellin subunits per cell during flagellar assembly . Successful bioengineering strategies include:

  • Signal sequence fusion: Fusing target proteins to the N-terminal secretion signals of native flagellar substrates, particularly those from late-assembly substrates like flagellin (FliC).

  • FlhB modification: Engineering FlhB to alter substrate specificity, potentially by modifying the autocleavage region or substrate recognition domains to accommodate non-native cargo proteins.

  • Gate optimization: Modifying components of the export gate complex, including FlhB, to enhance secretion efficiency or reduce selectivity while maintaining channel integrity.

Researchers have demonstrated that E. coli can secrete various heterologous proteins via the flagellar T3SS, with yields potentially reaching up to 1 g/L for certain proteins . When designing such systems, consideration should be given to the size limitations of the export channel, with optimal results typically observed for proteins under 50 kDa. Additionally, the structural characteristics of the target protein, including its folding kinetics and stability, significantly impact secretion efficiency.

What role does FlhB play in the substrate specificity switch during flagellar assembly?

FlhB functions as a critical checkpoint regulator that coordinates the sequential export of different flagellar components. The substrate specificity switch is essential for transitioning from early (rod and hook) to late (filament) substrate export, ensuring proper flagellar assembly:

  • Mechanistic basis: The autocleavage of FlhB at the conserved NPTH motif is central to this switch. This conformational change alters FlhB's interactions with other export apparatus components and with substrate proteins .

  • Integration with hook length control: FlhB works in concert with FliK, which acts as a molecular ruler measuring hook length. When the hook reaches its proper length (~55 nm), FliK interacts with FlhB to trigger the substrate specificity switch.

  • Interaction dynamics: Following autocleavage, the two resulting subdomains (FlhB-CN and FlhB-CC) remain tightly associated but undergo conformational changes that alter recognition of export substrates .

This substrate switching mechanism has been extensively studied in S. enterica, where mutations in the NPTH motif of FlhB result in the polyhook phenotype due to failure in transitioning to filament protein export . For E. coli researchers, comparable mutations would be expected to produce similar phenotypes, though species-specific differences in the fine details of regulation may exist.

How does the genomic context of flhB vary across E. coli strains and what are the implications?

The genomic organization surrounding flhB varies significantly across E. coli strains, with important implications for flagellar expression and function:

  • Standard genomic context: In most E. coli strains, including K-12 and O157:H7, flhB is located within the main flagellar gene cluster .

  • Alternative arrangements: In certain strains, additional flagellin-specifying loci have been identified. For example, some strains possess a genomic islet (GI) called the flk region, which contains the flkA (alternative flagellin) and flkB (fliC repressor) genes positioned between the chromosomal genes yhaC and rnpB .

  • Phase variation mechanism: In flk-positive E. coli strains (such as H3, H35, H36, H47, and H53), a unilateral flagellar phase variation mechanism has been documented, where the expression switches from "fliC off + flkA on" to "fliC on + flkA none" . This involves excision of the flk genomic islet through an integrase-mediated process .

This genomic diversity creates strain-specific variations in flagellar expression patterns and antigenic properties. When working with different E. coli strains, researchers should determine the specific genomic context of flhB and related flagellar genes to properly interpret experimental results. Strain-specific differences in regulatory mechanisms may affect recombinant expression strategies and functional studies of FlhB.

What strategies can overcome expression and solubility issues with recombinant FlhB?

Researchers often encounter challenges when expressing FlhB, particularly due to its transmembrane domain. Effective troubleshooting approaches include:

ChallengeSolution StrategyExperimental Implementation
Low expression levelsCodon optimizationSynthesize gene with E. coli preferred codons
Promoter selectionTest various promoters (T7, tac, ara) for optimal expression
Inclusion body formationTemperature reductionInduce at 16-18°C instead of 37°C
Solubility tagsFuse with MBP, SUMO, or Trx tags
Co-expression with chaperonesAdd plasmids encoding GroEL/GroES or DnaK/DnaJ/GrpE
Membrane protein solubilizationDetergent screeningTest panel of detergents (DDM, LDAO, OG)
Express soluble domains onlyFocus on cytoplasmic domain (FlhB-C)
Autocleavage during expressionMutation of NPTH motifIntroduce N→A mutation to prevent autocleavage
Rapid purificationMinimize time between cell lysis and purification

How can researchers accurately assess FlhB function in recombinant systems?

Validating the functional activity of recombinant FlhB requires multiple complementary approaches:

  • Complementation assays: Transform flhB deletion mutants with plasmids expressing recombinant FlhB variants. Functional complementation should restore motility, which can be quantified using swimming or swarming assays on semi-solid agar plates.

  • Autocleavage assessment: Monitor the self-cleavage activity of purified FlhB-C using SDS-PAGE and Western blotting. Functional FlhB will show time-dependent appearance of FlhB-CN and FlhB-CC fragments.

  • Interaction analysis: Verify binding to known partner proteins such as FliK using pull-down assays or surface plasmon resonance. The ability to interact with these partners correlates with functional integrity.

  • Flagellar protein secretion: Analyze culture supernatants for the presence of flagellar proteins, particularly flagellin. In functional systems, proper FlhB activity enables the secretion of late-stage flagellar components.

  • Structural verification: Use circular dichroism or limited proteolysis to confirm that recombinant FlhB maintains its native fold, particularly after purification procedures that might affect protein structure.

By combining these approaches, researchers can robustly assess whether recombinant FlhB maintains its physiological functions, ensuring the biological relevance of subsequent experiments and applications.

What emerging technologies are advancing our understanding of FlhB structure and dynamics?

Several cutting-edge technologies are transforming our ability to study FlhB structure and function:

  • Cryo-electron microscopy: Recent advances in cryo-EM have enabled visualization of previously inaccessible membrane protein complexes. This technology has revealed that the TMD of FlhB participates in the formation of the export gate as part of the FliPQR complex . Future high-resolution structures may elucidate the conformational changes associated with substrate switching.

  • Integrative structural biology: Combining multiple techniques (X-ray crystallography, NMR, SAXS, crosslinking-MS) provides comprehensive structural information about FlhB in different functional states.

  • Single-molecule techniques: FRET and optical tweezers allow researchers to monitor conformational changes of FlhB during substrate binding and export in real-time.

  • Molecular dynamics simulations: Computational approaches can model the interactions between FlhB and other flagellar components, predicting conformational changes induced by autocleavage or substrate binding.

  • In situ structural methods: Techniques like cryo-electron tomography enable visualization of the native flagellar export apparatus within bacterial cells, providing insights into the physiological context of FlhB function.

These technologies will help address critical questions regarding the molecular mechanisms of substrate recognition, the conformational changes triggered by autocleavage, and the dynamic interactions with other flagellar components during assembly.

How can knowledge of FlhB function inform the development of novel antimicrobial strategies?

Understanding FlhB function opens several avenues for antimicrobial development:

  • Targeting motility: Since FlhB is essential for flagellar assembly and bacterial motility, inhibitors of FlhB function could reduce bacterial dissemination during infection. This is particularly relevant for pathogens where motility is a virulence factor.

  • Disrupting type III secretion: The structural similarities between flagellar and virulence-associated T3SS suggest that FlhB inhibitors might simultaneously target both systems, potentially interfering with multiple virulence mechanisms.

  • Designing specific inhibitors: The conserved NPTH motif and autocleavage mechanism present unique targets for small molecule inhibitors. Compounds that bind to this region could prevent the conformational changes necessary for substrate switching.

  • Combination strategies: FlhB inhibitors could sensitize bacteria to existing antibiotics by preventing their dissemination or reducing biofilm formation, which often involves flagella-mediated surface attachment in its initial stages.

  • Vaccine development: Understanding the immunogenic properties of FlhB and its involvement in flagellar assembly could inform the design of vaccines targeting conserved epitopes of the flagellar export apparatus.

Research in this direction would benefit from high-throughput screening approaches to identify compounds that specifically interact with FlhB, combined with structural studies to optimize binding and specificity. While targeting motility alone may not be bactericidal, such approaches could significantly reduce virulence or enhance the efficacy of conventional antibiotics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.