Recombinant Escherichia coli Flagellar biosynthetic protein fliP (fliP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
fliP; flaR; b1948; JW1932; Flagellar biosynthetic protein FliP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-245
Protein Length
Full Length of Mature Protein
Species
Escherichia coli (strain K12)
Target Names
fliP
Target Protein Sequence
QLPGITSQPLPGGGQSWSLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGTP SAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQEALEKGAQPLREFMLRQ TREADLGLFARLANTGPLQGPEAVPMRILLPAYVTSELKTAFQIGFTIFIPFLIIDLVIA SVLMALGMMMVPPATIALPFKLMLFVLVDGWQLLVGSLAQSFYS
Uniprot No.

Target Background

Function
Plays a role in the flagellum-specific transport system.
Database Links
Protein Families
FliP/MopC/SpaP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the structural composition and localization of FliP in E. coli?

FliP is a hydrophobic polypeptide with a molecular mass of approximately 26.9 kDa that forms part of the membrane-embedded flagellar export apparatus in E. coli . The protein is initially synthesized as a precursor containing an N-terminal signal peptide of 21 amino acids, indicating its membrane targeting mechanism . FliP localizes to the bacterial inner membrane as one of five essential components (along with FlhA, FlhB, FliQ, and FliR) that constitute the core of the flagellar secretion apparatus . Structural studies suggest that FliP monomers assemble into a ring-like configuration with a central cavity that forms the protein-conducting channel . This arrangement is consistent with its function in facilitating protein transport during flagellar assembly.

How does FliP function within the flagellar export apparatus?

FliP appears to serve as the primary protein-conducting conduit within the flagellar secretion system . Multiple lines of evidence support this function, including chemical modification experiments demonstrating that positions near the center of certain FliP transmembrane segments are accessible to polar reagents, suggesting the presence of a water-filled channel . FliP forms a pore that is particularly conductive to guanidinium ions and can sensitize cells to certain cations when expressed . The protein works in concert with other flagellar export components, with FlhA likely coupling to the proton gradient to energize the system while FliP provides the physical conduit for protein translocation . This protein translocation function aligns with the roles of FliP homologs found in other bacterial species .

What genetic context surrounds fliP in the E. coli genome?

The fliP gene is situated within the fliL operon of E. coli, which contains a total of seven genes involved in flagellar biosynthesis and function . Within this operon, fliP is positioned alongside fliO, fliQ, and fliR, comprising four adjacent genes that can be complemented by a 2.2-kb PstI restriction fragment . DNA sequence analysis has identified distinct open reading frames for each of these genes, allowing for their functional characterization through complementation studies . The organization of these genes within a single operon suggests coordinated expression and functional relationships between their protein products in the assembly and operation of the flagellar apparatus.

What experimental approaches are most effective for studying FliP function in flagellar protein secretion?

When investigating FliP function, a multi-faceted experimental approach yields the most comprehensive insights. Chemical modification techniques using polar reagents can assess accessibility of transmembrane segments, providing structural information about the conducting pore . Conductance experiments using osmotic upshift with various ions (particularly guanidinium) can evaluate the pore-forming capacity of wild-type and mutant FliP variants . Expression systems such as the T7 promoter-polymerase system have proven effective for identifying and characterizing the FliP protein product . For genetic studies, complementation analysis using the 2.2-kb PstI restriction fragment containing the complete fliP gene can restore function in fliP mutant strains . When examining structure-function relationships, site-directed mutagenesis targeting conserved residues (such as the three conserved methionines) can reveal critical functional domains . These mutations can then be assessed through motility assays to determine their impact on flagellar function .

How do researchers address contradictions in experimental data when studying FliP?

When confronting contradictory data in FliP research, a systematic analytical approach is essential. First, researchers should carefully evaluate the experimental conditions that may have influenced divergent results, as FliP function is highly context-dependent . For instance, FliP's ion conductance properties differ significantly between ΔflhDC and ΔfliP genetic backgrounds, suggesting interactions with other flagellar components affect its activity . When facing contradictions, researchers should adopt an exploratory "night science" approach as described by Whitehead: "In formal logic, a contradiction is the signal of defeat, but in the evolution of real knowledge, it marks the first step in progress toward a victory" . This means embracing the contradiction as an opportunity to discover new aspects of FliP biology rather than dismissing conflicting data . Practical approaches include reanalyzing data with different parameters, considering alternative hypotheses about FliP's functional mechanisms, and designing experiments that specifically test competing models of FliP action . Critically, researchers must avoid confirmation bias when interpreting results, as preconceived notions about FliP function can significantly influence data interpretation .

What are the key considerations when designing site-directed mutagenesis experiments for FliP?

When designing site-directed mutagenesis experiments for FliP, researchers should prioritize several critical factors. Selection of target residues should focus on highly conserved amino acids across bacterial species, as these often indicate functional importance . The three conserved methionine residues in FliP have proven particularly informative, as their replacement with either alanine or phenylalanine yields distinct functional outcomes . Mutations should target different structural regions of FliP to comprehensively map functional domains, including the N-terminal signal peptide, transmembrane segments, and potential pore-forming regions . The choice of substitution amino acids is crucial—replacing methionines with alanines (similar size) versus phenylalanines (larger) has revealed that side-chain size and flexibility in certain regions are essential for function . Multiple experimental readouts should be employed to assess mutant phenotypes, including motility assays for flagellar function, conductance measurements for pore activity, and sensitivity to various ions to evaluate channel selectivity . Control mutations in non-conserved residues should be included to distinguish specific functional effects from general structural disruption. Finally, researchers should consider creating series of progressive mutations (single, double, triple) to identify potential cooperative interactions between different regions of the FliP protein .

How does the relationship between FliP and its homologs inform our understanding of type-III secretion systems?

The evolutionary and functional relationships between FliP and its homologs provide critical insights into type-III secretion systems across bacterial species. FliP shows significant homology to proteins encoded by DNA sequences in Rhizobium meliloti, Xanthomonas campestris pv. glycines, and the spa24 gene of Shigella flexneri . This conservation suggests FliP performs fundamentally important functions that have been preserved across diverse bacterial lineages . The homology with proteins involved in pathogenicity (as in X. campestris) and protein translocation (as in S. flexneri) indicates that FliP's role in protein secretion extends beyond flagellar assembly to virulence mechanisms . Recent structural studies on SpaP, a FliP homolog, reveal that these proteins likely assemble into pentameric rings with central cavities, providing a structural framework for understanding FliP's organization . Comparative analyses between flagellar and virulence-associated secretion systems demonstrate remarkable similarities in core components, with FliP and its homologs serving as the primary protein-conducting channels in both contexts . This conservation suggests that the flagellar export system may have been evolutionarily repurposed for virulence factor secretion in pathogenic bacteria, highlighting the broader significance of FliP research beyond motility studies .

What methodologies are most effective for producing and purifying recombinant FliP for structural studies?

Producing and purifying functional recombinant FliP presents significant challenges due to its hydrophobic nature and integration within membrane complexes. For expression systems, the T7 promoter-polymerase system has demonstrated success in producing detectable levels of FliP protein . When designing expression constructs, researchers should consider including the 21-amino acid N-terminal signal peptide to ensure proper membrane targeting, though removal of this sequence may be necessary for certain structural analyses . Membrane protein extraction requires careful optimization of detergent conditions to solubilize FliP while maintaining its native conformation—mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) typically yield better results than harsh ionic detergents. Purification strategies should employ affinity tags positioned to minimize interference with FliP folding and oligomerization; C-terminal tags are often preferable as they avoid disrupting the signal peptide processing . For structural studies, researchers must evaluate whether to study FliP in isolation or as part of its native complex with FliO, FliQ, and FliR, as isolated FliP may not adopt its physiologically relevant conformation . Reconstitution into nanodiscs or liposomes following purification can provide a more native-like membrane environment for functional studies. Finally, quality control assessments should verify proper folding and oligomeric state, as recent evidence suggests FliP functions as a pentameric assembly similar to its homolog SpaP .

How can researchers effectively design experiments to study FliP's role in flagellar protein secretion?

When designing experiments to investigate FliP's function in flagellar protein secretion, researchers should implement a multi-level experimental strategy. At the genetic level, construction of precise fliP deletion mutants using CRISPR-Cas9 or lambda Red recombination provides clean backgrounds for complementation studies . Complementation analyses should utilize various truncated or mutated fliP constructs to identify critical functional domains . For protein-level studies, researchers can employ in vivo protein labeling techniques with fluorescent tags or epitopes to track FliP localization and complex formation within the bacterial membrane . To assess secretion function directly, export assays measuring the accumulation of flagellar proteins (such as FliC) in the culture medium of wild-type versus fliP mutant strains can quantify secretion efficiency . Researchers should incorporate conductance measurements using osmotic upshift experiments with various ions to characterize the pore-forming properties of FliP variants . For structure-function analyses, cysteine-scanning mutagenesis paired with accessibility studies using sulfhydryl reagents can map the pore-lining residues of the FliP channel . When interpreting results, it's essential to consider the genetic background, as FliP's function differs significantly between ΔflhDC (lacking all flagellar proteins) and ΔfliP backgrounds, indicating important interactions with other flagellar components . These comprehensive approaches provide a robust framework for elucidating FliP's specific contributions to the flagellar export mechanism.

How should researchers design experiments to investigate the oligomeric structure of FliP in the membrane?

Investigating FliP's oligomeric structure requires specialized techniques addressing the challenges of membrane protein analysis. Researchers should employ in vivo crosslinking with membrane-permeable agents like DSP (dithiobis[succinimidyl propionate]) or formaldehyde to capture native oligomeric states before membrane disruption . Blue native PAGE combined with Western blotting can preserve and detect native complexes, providing information about approximate molecular weight and stability of FliP assemblies . For higher resolution structural information, cryo-electron microscopy of purified FliP complexes reconstituted in nanodiscs offers the potential for near-atomic resolution, building on successful approaches used with the FliP homolog SpaP that revealed a pentameric ring structure . Genetic approaches using suppressor mutation analysis can identify residues involved in subunit interfaces—mutations disrupting oligomerization might be compensated by secondary mutations at interaction surfaces . FRET (Förster Resonance Energy Transfer) assays using FliP variants labeled with donor and acceptor fluorophores can provide direct evidence of proximity between subunits and help map interaction domains . Mass spectrometry of intact membrane complexes is increasingly viable for determining precise stoichiometry and subunit arrangement. When designing these experiments, researchers should consider the potential influence of detergent selection on oligomeric stability, as inappropriate detergents can disrupt native interactions . Comparative studies between FliP and its well-characterized homolog SpaP can guide experimental design, as the pentameric arrangement observed for SpaP provides a testable model for FliP oligomerization .

How can researchers reconcile contradictory findings about FliP function across different experimental systems?

Reconciling contradictory findings about FliP requires systematic evaluation of the experimental factors that influence its behavior. Researchers should first conduct a comprehensive contextual analysis comparing the genetic backgrounds, growth conditions, and expression systems used across studies, as FliP function depends significantly on these parameters . For instance, FliP shows different ion conductance properties in ΔflhDC versus ΔfliP backgrounds, suggesting interactions with other flagellar components affect its activity . A methodological deconstruction approach, where experimental protocols are compared step-by-step, can identify critical variations in techniques that might explain divergent results . Rather than viewing contradictions as experimental failures, researchers should adopt the perspective articulated by Alfred North Whitehead: "In formal logic, a contradiction is the signal of defeat, but in the evolution of real knowledge, it marks the first step in progress toward a victory" . This means using contradictions as starting points for developing more nuanced models of FliP function . Integrative data analysis combining results from multiple experimental approaches (genetic, biochemical, structural) can reveal a more complete picture that resolves apparent contradictions . When disparate findings persist, researchers should design critical experiments specifically targeting the contradiction—for example, if FliP shows different conductance properties across studies, direct comparison using standardized methods in both experimental systems can clarify the source of variation . Finally, computational modeling can help integrate diverse experimental observations into coherent mechanistic models that account for context-dependent behavior .

How should researchers analyze the evolutionary relationships between FliP and homologous proteins in other bacterial species?

Analyzing the evolutionary relationships between FliP and its homologs requires a systematic comparative approach. Researchers should begin with comprehensive sequence alignment of FliP proteins across diverse bacterial species, identifying both highly conserved regions—likely crucial for function—and variable regions that may reflect species-specific adaptations . Phylogenetic analysis using maximum likelihood or Bayesian methods can establish evolutionary relationships between FliP variants and determine whether sequence divergence correlates with bacterial phylogeny or functional specialization . Domain architecture analysis comparing the arrangement of transmembrane segments, signal sequences, and functional motifs across FliP homologs can reveal evolutionary constraints on protein structure . For deeper functional insights, researchers should conduct comparative studies between FliP and homologs with known functions in other secretion systems, such as the virulence-associated proteins in Xanthomonas campestris and Shigella flexneri . Synteny analysis examining the genomic context of fliP across species can identify conserved operonic structures and potential co-evolution with interacting partners . Selective pressure analysis using dN/dS ratios can identify regions under purifying selection (functionally constrained) versus positive selection (potentially adapting to new functions) . Researchers should also compare the pentameric structure proposed for the FliP homolog SpaP with structural data from diverse FliP proteins to determine whether oligomeric arrangement is evolutionarily conserved . Finally, horizontal gene transfer analysis can reveal whether fliP genes have been exchanged between flagellar systems and pathogenicity-associated secretion systems, providing insight into the evolutionary origins of these functionally related but distinct machineries .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.