Recombinant Escherichia coli Flagellar M-ring protein (fliF)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Flagellar Assembly

FliF is the first component assembled during flagellar biosynthesis, forming a 26-subunit MS ring . Key functions include:

  • Export Apparatus Housing: The MS ring’s central pore houses the flagellar type III secretion system (T3SS), facilitating protein export .

  • Motor Integration: Direct interaction with FliG ensures C-ring assembly, essential for motor rotation and directional switching .

  • Structural Stability: Deletions in the C-terminal domain (e.g., ∆26 residues) disrupt FliF turnover and flagellar assembly .

Recombinant FliF in Biotechnological Applications

Genetic engineering of E. coli strains involving FliF-related pathways has enhanced recombinant protein yields:

Table 1: Metabolic and Yield Outcomes of fliF-Associated Mutations

Strain ModificationGlucose Uptake (g/L)Recombinant Protein Yield (vs WT)Key Metabolic Shift
ptsG knockout (Wp)12.491.5×Reduced overflow metabolism
ptsG/flhC knockout (Wpf)7.541.81×Enhanced PPP/TCA flux, ATP/NADPH

Deleting flhC (a flagellar regulator) in ptsG-null strains redistributed carbon flux toward ATP/NADPH synthesis, improving yield per glucose unit . Co-expression of phage shock protein A (PspA) further increased soluble periplasmic protein yields .

Genetic and Phenotypic Interactions

  • Suppressor Mutations: Specific FliF mutations (e.g., ∆A174/S175) are suppressed by FlhA mutations, confirming physical MS ring–export apparatus interactions .

  • Dominance Effects: Mutant FliF partially dominates wild-type FliF in C-ring assembly, highlighting its structural prioritization .

Future Directions

  • Mechanistic Studies: How FliF’s DQxGxxL motif enables symmetry transitions during MS ring assembly .

  • Industrial Optimization: Leveraging fliF/flhC regulatory linkages to design high-yield E. coli chassis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
fliF; fla; AII.1; BI; b1938; JW1922; Flagellar M-ring protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
fliF
Target Protein Sequence
MNATAAQTKSLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAPDYRTLFSNLSDQDG GAIVSQLTQMNIPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEKFGI SQFSEQVNYQRALEGELSRTIETIGPVKGARVHLAMPKPSLFVREQKSPSASVTVNLLPG RALDEGQISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQSNTSGRDLNDAQLKYASDVEG RIQRRIEAILSPIVGNGNIHAQVTAQLDFASKEQTEEQYRPNGDESHAALRSRQLNESEQ SGSGYPGGVPGALSNQPAPANNAPISTPPANQNNRQQQASTTSNSGPRSTQRNETSNYEV DRTIRHTKMNVGDVQRLSVAVVVNYKTLPDGKPLPLSNEQMKQIEDLTREAMGFSEKRGD SLNVVNSPFNSSDESGGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRA EAMKAVQQQAQAREEVEDAVEVRLSKDEQLQQRRANQRLGAEVMSQRIREMSDNDPRVVA LVIRQWINNDHE
Uniprot No.

Target Background

Function
The M ring is believed to play an active role in energy transduction.
Database Links
Protein Families
FliF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the basic structure of the FliF protein in E. coli?

FliF is a membrane protein that forms the MS-ring of the bacterial flagellum. It contains two transmembrane helices and a large periplasmic region. The periplasmic region of FliF consists of three ring-building motifs (RBMs): RBM1, RBM2, and RBM3. Crystal structure analysis has revealed that the N-terminal half of the periplasmic region (specifically residues 58-213 in Aquifex aeolicus) is composed of two domains, D1 and D2, which show structural similarity to corresponding domains of type III secretion system components .

What is the symmetry pattern of the MS-ring formed by FliF?

The MS-ring exhibits a fascinating symmetry mismatch. Electron cryomicroscopy (cryoEM) analysis has revealed that the inner part of the M-ring shows a gear wheel-like density with the inner ring displaying C23 symmetry (23-fold rotational symmetry) surrounded by cogs with C11 symmetry. A total of 34 copies of FliF D1-D2 fit well into this structure. The S-ring shows C34 symmetry. This unusual arrangement suggests that FliF D1-D2 adopts two distinct orientations in the M-ring relative to the rest of FliF, with 23 chains forming the wheel structure and 11 chains forming the cogs .

How does the structure of FliF compare to homologous proteins in other systems?

FliF shares structural homology with the inner membrane ring components of the Type III Secretion (T3S) injectisome, specifically SctJ (also named EscJ in enteropathogenic E. coli and PrgK in Salmonella SPI-1) and SctD (EscD in EPEC and PrgH in SPI-1). It also shares similarities with Bacillus sporulation channel components SpoIIIAH and SpoIIIAG. The ring-building motifs (RBMs) of FliF are conserved in these homologous systems: RBM1 is conserved in SctJ/SctD, RBM2 in SctJ/SctD/SpoIIIAH, and RBM3 in SpoIIIAG. This structural conservation suggests evolutionary relationships between these different bacterial nanomachines .

What is the role of FliF in flagellar assembly?

FliF plays a crucial role as the foundation for flagellar assembly. Flagellar formation is initiated by the assembly of the type III export gate complex (composed of FlhA, FlhB, FliP, FliQ, and FliR with the help of the FliO scaffold), followed by the recruitment of FliF through interaction with FlhA to form the MS-ring around the export gate complex. The MS-ring then stabilizes the export gate complex, which is essential for further flagellar assembly. Without FliF, the export gate component proteins can form partial gate complexes but cannot assemble into the complete export gate complex, highlighting FliF's essential role in the assembly process .

How does FliF interact with FliG in the flagellar motor?

The binding of FliG to FliF is one of the first critical interactions in the assembly of the bacterial flagellum. This interaction is integral for anchoring the flagellar cytoplasmic ring (C-ring), which is responsible for both torque transmission and control of rotational direction, to the central transmembrane MS-ring. NMR studies have suggested that the primary interaction site for the C-terminal domain of FliF (FliF C) is located on a conserved hydrophobic patch centered along helix 1 of the N-terminal domain of FliG (FliG N) . This interaction is essential for flagellar assembly and function.

What methodologies are used to study FliF-FliG interactions?

Researchers employ various techniques to study the interaction between FliF and FliG:

  • NMR Spectroscopy: 1H-15N TROSY-HSQC experiments with 15N, 2H-labeled FliG N and synthetic FliF C peptides have been used to identify interaction sites .

  • Cross-linking Studies: Cysteine residues introduced at specific positions in FliG can be cross-linked using bifunctional sulfhydryl-specific cross-linkers like BMH (bismaleimidohexane). The cross-linked products are then analyzed by immunoblotting with FliG antibodies to determine interaction sites and proximities .

  • X-ray Crystallography: Crystal structures of protein domains provide high-resolution structural information. For example, the crystal structure of FliF 58-213 was determined at 2.3-Å resolution .

  • CryoEM Analysis: This technique provides lower-resolution but comprehensive structural information about the assembled flagellar components, including the MS-ring formed by FliF .

How does the conformational heterogeneity of FliF contribute to flagellar function?

The structural analysis of the MS-ring reveals that FliF adopts two distinct conformations in the assembled structure. This conformational heterogeneity results in the observed symmetry mismatches: 23-fold symmetry in one part, 11-fold in another, and 34-fold in the S-ring.

This unusual arrangement likely serves multiple functions:

  • Structural Adaptation: The ability of FliF to adopt different conformations may allow the MS-ring to interface with both the membrane and the other flagellar components that have different symmetries.

  • Energy Transmission: The complex symmetry pattern might facilitate the mechanical energy transmission required for flagellar rotation.

  • Assembly Control: The distinct conformations may play a role in controlling the sequential assembly of flagellar components.

Future research using high-resolution structural techniques coupled with molecular dynamics simulations could further elucidate how these conformational states contribute to flagellar function .

What are the experimental approaches for studying symmetry mismatches in the MS-ring?

Studying the complex symmetry pattern of the MS-ring requires sophisticated experimental approaches:

  • High-Resolution CryoEM: Modern cryoEM techniques with direct electron detectors can achieve resolutions that reveal the asymmetric arrangement of subunits. This involves:

    • Sample vitrification under optimal conditions

    • Collection of tilt series data

    • Image processing with specialized software that can handle heterogeneous structures

    • Focused classification approaches to separate different conformational states

  • Hybrid Structural Methods: Combining:

    • X-ray crystallography data of individual domains

    • CryoEM maps of the assembled complex

    • Computational modeling to fit atomic structures into lower-resolution maps

  • Site-Directed Mutagenesis: Introducing mutations at the interface of differently oriented FliF subunits can help understand the determinants of the symmetry pattern .

How can structural information about FliF be used to engineer novel flagellar-based biotechnology applications?

Understanding the structural basis of FliF assembly and function opens possibilities for bioengineering applications:

  • Engineered Molecular Motors: The detailed knowledge of how FliF forms the MS-ring could inform the design of synthetic molecular motors based on the flagellar architecture.

  • Protein Export Systems: Since FliF interacts with the type III secretion export apparatus, engineered FliF variants could potentially be used to develop novel protein export systems for biotechnological applications.

  • Bacterial Surface Display: Modified FliF could be used as an anchor for displaying proteins of interest on bacterial surfaces.

  • Targeted Drug Delivery: Engineered flagellar structures could potentially be adapted for targeted delivery of therapeutic molecules.

These applications would require a deep understanding of structure-function relationships in FliF and the ability to introduce specific modifications that maintain structural integrity while adding novel functionalities .

What are the recommended protocols for recombinant expression and purification of FliF?

Based on the research literature, successful expression and purification of FliF typically follows these approaches:

  • Expression Systems:

    • E. coli BL21(DE3) or derivatives are commonly used

    • For full-length FliF (containing transmembrane domains), specialized expression strains like C43(DE3) may be preferable

    • For soluble domains (e.g., periplasmic region), standard BL21(DE3) is usually sufficient

  • Expression Constructs:

    • Cloning FliF fragments into pET series vectors with appropriate affinity tags (6×His, GST)

    • For structural studies, expressing specific domains (e.g., residues 58-213 as in the Aquifex aeolicus FliF crystal structure) rather than the full-length protein

  • Purification Strategy:

    • For membrane-bound full-length FliF:

      • Membrane fraction isolation

      • Solubilization with mild detergents (DDM, LMNG)

      • Affinity chromatography

      • Size exclusion chromatography

    • For soluble domains:

      • Standard affinity chromatography

      • Ion exchange chromatography

      • Size exclusion chromatography

  • Quality Control:

    • SDS-PAGE and western blotting

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for homogeneity assessment

What structural analysis techniques are most informative for studying FliF?

Multiple complementary structural techniques have proven valuable for FliF characterization:

  • X-ray Crystallography:

    • Best suited for high-resolution analysis of individual FliF domains

    • Requires production of diffraction-quality crystals

    • The structure of FliF 58-213 was determined at 2.3-Å resolution using this method

  • Cryo-Electron Microscopy:

    • Essential for visualizing the entire MS-ring structure

    • Can reveal the arrangement of FliF subunits in the assembled state

    • Modern single-particle cryoEM can achieve near-atomic resolution

    • Particularly valuable for observing symmetry mismatches and conformational heterogeneity

  • NMR Spectroscopy:

    • Useful for studying interactions between FliF and other flagellar proteins

    • Can detect conformational changes upon binding

    • Requires isotope-labeled proteins (15N, 13C, 2H)

  • Molecular Dynamics Simulations:

    • Complements experimental structural data

    • Can predict conformational changes and dynamic behavior

    • Helps interpret experimental observations in the context of protein flexibility

What mutagenesis approaches are most effective for studying FliF function?

Several mutagenesis strategies have proven valuable for dissecting FliF function:

  • Alanine-Scanning Mutagenesis:

    • Systematically replacing residues with alanine to identify functionally important regions

    • Particularly useful for mapping interaction sites with other flagellar proteins

  • Domain Deletion and Chimeric Proteins:

    • Removing or replacing specific domains to assess their contribution to function

    • Creating chimeric proteins with domains from homologous systems (e.g., injectisome components)

  • Cysteine Pair Mutagenesis:

    • Introducing pairs of cysteine residues at specific positions

    • Using cross-linking reagents to probe proximity relationships

    • Particularly useful for studying the arrangement of FliF subunits in the assembled state

  • Charge Reversal Mutations:

    • Changing charged residues to oppositely charged ones

    • Effective for studying electrostatic interactions with other flagellar components

Each mutation should be assessed for:

  • Protein expression and stability

  • MS-ring assembly

  • Flagellar function (motility assays)

  • Interaction with partner proteins (pull-down assays)

What are the current limitations in understanding FliF structure and function?

Despite significant progress, several challenges remain in FliF research:

  • Complete Structural Characterization:

    • While the structure of domains like D1-D2 has been determined, the complete structure of full-length FliF in the assembled MS-ring at high resolution remains elusive.

    • The precise arrangement of the transmembrane helices and their interactions with the membrane are not fully characterized.

  • Dynamic Aspects:

    • The conformational changes that FliF might undergo during flagellar assembly and function are not well understood.

    • How FliF accommodates the insertion of the type III secretion apparatus remains to be fully elucidated.

  • Species-Specific Variations:

    • Most detailed structural studies have been conducted on thermophilic species like Aquifex aeolicus rather than E. coli.

    • The extent to which findings can be generalized across species requires further investigation.

  • Integration with Other Flagellar Components:

    • The complete interaction network of FliF with all relevant flagellar proteins has not been mapped in detail.

    • The temporal sequence of these interactions during flagellar assembly needs further clarification .

How can contradictions in the FliF structural data be reconciled?

Researchers occasionally encounter contradictory structural data regarding FliF. These contradictions can be addressed through several approaches:

  • Resolution Differences:

    • Different structural techniques (X-ray crystallography, cryoEM) provide data at different resolutions.

    • Higher-resolution techniques may reveal details that resolve apparent contradictions from lower-resolution studies.

  • Conformational Flexibility:

    • FliF adopts multiple conformations in the MS-ring (as evidenced by the symmetry mismatches).

    • Apparent contradictions may reflect different conformational states rather than errors.

  • Experimental Conditions:

    • Comparing results from experiments conducted under different conditions (pH, salt concentration, detergent choice).

    • Standardizing conditions when possible or explicitly accounting for differences.

  • Integrative Structural Biology:

    • Combining multiple structural techniques to build comprehensive models.

    • Using computational approaches to integrate diverse experimental data.

    • Molecular dynamics simulations to explore conformational space.

  • Species Differences:

    • Careful comparison of FliF from different bacterial species to identify conserved features versus species-specific adaptations .

What emerging technologies hold promise for advancing FliF research?

Several cutting-edge technologies could significantly advance our understanding of FliF:

  • Cryo-Electron Tomography (Cryo-ET):

    • Enables visualization of flagellar structures in their native cellular context.

    • Could reveal how the MS-ring integrates with both the membrane and other flagellar components.

  • Time-Resolved Structural Methods:

    • Techniques like time-resolved cryo-EM or X-ray free-electron laser (XFEL) studies.

    • Could capture intermediate states during flagellar assembly or function.

  • Single-Molecule FRET:

    • Monitoring conformational changes in FliF during flagellar assembly and function.

    • Could provide insights into the dynamics of FliF that are inaccessible to static structural methods.

  • AlphaFold and Other AI Structure Prediction Tools:

    • Predicting structures of full-length FliF and its complexes.

    • Generating hypotheses about interactions that can be tested experimentally.

  • CRISPR-Based Genome Editing:

    • Creating precise chromosomal mutations in the native fliF gene.

    • Studying the effects in the context of all native flagellar gene expression regulation.

  • In-Cell NMR and EPR:

    • Studying FliF structure and dynamics in a cellular environment.

    • Could provide insights that are difficult to obtain from purified systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.