Recombinant Escherichia coli Flagellar protein fliO (fliO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
fliO; flaP; flbD; b1947; JW5316; Flagellar protein FliO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
fliO
Target Protein Sequence
MNNHATVQSSAPVSAAPLLQVSGALIAIIALILAAAWLVKRLGFAPKRTGVNGLKISASA SLGARERVVVVDVEDARLVLGVTAGQINLLHKLPPSAPTEEIPQTDFQSVMKNLLKRSGR S
Uniprot No.

Target Background

Database Links
Protein Families
FliO/MopB family
Subcellular Location
Cell membrane; Single-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is Flagellar protein fliO and what is its role in flagellar biogenesis?

Flagellar protein fliO is a membrane-bound component of the flagellar export apparatus in bacteria such as Escherichia coli and Helicobacter pylori. It plays a critical role in flagellar assembly and bacterial motility. Although it is the least conserved of the membrane-bound components of the export apparatus, research has demonstrated that FliO is necessary for normal flagellar biogenesis .

In H. pylori studies, disruption of fliO resulted in significantly reduced motility, with most cells (93.5%) becoming aflagellated. Only a small percentage of cells maintained a single flagellum (6%) or two flagella (0.5%), compared to wild-type cells where the majority (93%) were flagellated with two to four flagella . This indicates that while FliO is required for optimal flagellar biogenesis, it is not absolutely essential, as some mutant cells still developed flagella.

FliO also appears to be necessary for maintaining wild-type levels of the export apparatus protein FlhA in the membrane, suggesting it may play a role in stabilizing other components of the flagellar export system .

How should researchers store and reconstitute recombinant FliO protein?

Proper storage and reconstitution of recombinant FliO protein is crucial for maintaining its activity in research applications. The protein is typically available in either lyophilized powder form or in a liquid buffer.

Storage recommendations:

  • Store upon receipt at -20°C to -80°C

  • Aliquoting is necessary for multiple uses to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the typical default)

  • Aliquot for long-term storage at -20°C/-80°C

The typical storage buffer for the liquid form is Tris/PBS-based buffer with 5-50% glycerol, while the lyophilized form utilizes Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How does FliO contribute to flagellar gene expression regulation?

FliO plays a significant role in regulating flagellar gene expression. Research on H. pylori has revealed that disruption of fliO affects the transcription of both RpoN-dependent and FliA-dependent flagellar genes .

Compared to wild-type strains, fliO mutants showed:

  • ~24-fold reduction in flaB and flgE transcript levels (RpoN-dependent genes)

  • ~7-fold reduction in flaA transcript levels (FliA-dependent gene)

  • Normal levels of flgR, flgS, and fliA transcripts and RpoN protein

These findings indicate that the lower transcript levels of flagellar genes in fliO mutants were not due to reduced expression of regulatory genes required for transcription of the RpoN and FliA regulons. Instead, FliO appears to be directly involved in the regulatory pathway that activates transcription of these flagellar genes .

Complementation studies showed that introducing plasmid-borne fliO into the ΔfliO mutant partially restored flagellar gene transcript levels, confirming FliO's role in gene regulation .

What are the functional differences between the domains of FliO protein?

Research on H. pylori FliO has identified distinct functional domains with varying contributions to flagellar assembly and regulation. Truncation studies have revealed important insights about domain functionality:

N-terminal Domain (residues 26-174):

  • Forms a large periplasmic domain in H. pylori (absent in E. coli and Salmonella)

  • Somewhat dispensable for flagellar gene regulation and assembly

  • Deletion affects function but does not completely abolish it

Transmembrane Regions:

  • Essential for proper FliO localization and function

  • Critical for integration into the membrane-bound export apparatus

C-terminal Domain (residues 217-283):

  • Located in the cytoplasm

  • Like the N-terminal domain, somewhat dispensable for flagellar gene regulation and assembly

  • Deletion impacts function but not as severely as disruption of the full protein

These findings suggest that while the periplasmic and cytoplasmic domains have roles in flagellar synthesis, they are less critical than the transmembrane regions. This domain-specific functionality offers potential targets for experimental manipulation to study FliO function .

How does FliO from E. coli compare to FliO homologs in other bacterial species?

FliO exhibits significant structural and functional variations across bacterial species, making comparative studies valuable for understanding evolutionary adaptations of the flagellar system:

E. coli FliO:

  • 121 amino acids in length

  • Lacks the large N-terminal periplasmic domain found in H. pylori

  • Functions as part of the flagellar export apparatus

H. pylori FliO:

  • Contains a large N-terminal periplasmic domain absent in E. coli and Salmonella

  • Required for flagellar biogenesis and wild-type levels of motility

  • Deletion results in 93.5% of cells becoming aflagellated

  • Necessary for wild-type levels of flagellar gene expression

  • Required for normal levels of FlhA protein in the membrane

Conservation status:
FliO is described as the least conserved of the membrane-bound components of the export apparatus, which explains why it has not been annotated in some bacterial genome sequences, including some H. pylori genomes . This variability makes it an interesting target for studying evolutionary adaptation of flagellar systems across bacterial species.

What experimental approaches are used to study FliO function?

Several methodological approaches have proven effective for investigating FliO function:

1. Gene Disruption and Complementation:

  • Disrupt fliO gene with antibiotic resistance cassettes (e.g., cat cassette)

  • Introduce plasmid-borne wild-type or mutant fliO alleles for complementation

  • Analyze phenotypic changes in motility and flagellar structure

2. Domain Truncation Studies:

  • Create truncated versions of FliO using overlapping PCR

  • Replace specific domains with FLAG tags for detection

  • Express truncated versions in fliO deletion mutants to assess function

  • Examples include:

    • N-terminal deletion (ΔN): replace amino acids 26-174 with FLAG tag

    • C-terminal deletion (ΔC): replace amino acids 217-283 with FLAG tag

    • Combined N- and C-terminal deletion (TM): retain only transmembrane regions

3. Motility Assays:

  • Use soft agar plates to quantify bacterial motility

  • Compare halo sizes between wild-type, mutant, and complemented strains

4. Microscopy Analysis:

  • Employ transmission electron microscopy to visualize flagellar structures

  • Quantify the number of flagella per cell in different genetic backgrounds

5. Gene Expression Analysis:

  • Use quantitative PCR to measure transcript levels of flagellar genes

  • Compare expression of RpoN-dependent genes (e.g., flaB, flgE) and FliA-dependent genes (e.g., flaA)

  • Include regulatory genes (flgR, flgS, fliA) as controls

What challenges do researchers face when working with recombinant FliO protein?

Researchers working with recombinant FliO face several technical challenges:

1. Protein Stability Issues:

  • FliO is a membrane protein, making it inherently less stable in solution

  • Repeated freeze-thaw cycles can degrade protein quality and should be avoided

  • Working aliquots at 4°C maintain viability for approximately one week

2. Reconstitution Complexity:

  • Proper reconstitution requires careful buffer selection

  • Addition of stabilizing agents like glycerol (5-50%) is necessary for maintaining function

  • Complete solubilization may require optimization of buffer conditions

3. Expression System Limitations:

  • Typically expressed in E. coli systems, which may introduce host-specific modifications

  • Membrane protein overexpression can be toxic to host cells

  • Achieving high purity (>90%) requires optimized purification protocols

4. Functional Assessment:

  • As a component of a multi-protein complex (flagellar export apparatus), isolated FliO may not fully recapitulate in vivo functionality

  • In vitro assays may not capture the complex interactions within the native membrane environment

5. Species-Specific Variations:

  • Significant structural differences between FliO homologs from different bacterial species

  • E. coli FliO lacks domains present in other species (e.g., H. pylori's N-terminal periplasmic domain)

  • These variations necessitate species-specific experimental approaches

What experimental setups are optimal for studying FliO-protein interactions?

Investigating FliO interactions with other flagellar proteins requires specialized experimental approaches:

Co-immunoprecipitation Studies:

  • Express epitope-tagged FliO (e.g., His-tagged) in bacterial cells

  • Lyse cells under conditions that preserve protein-protein interactions

  • Use antibodies against the tag to pull down FliO and associated proteins

  • Analyze co-precipitated proteins by mass spectrometry or immunoblotting

Bacterial Two-Hybrid System:

  • Clone fliO and potential interaction partners into two-hybrid vectors

  • Transform into reporter strains and assess interaction through reporter gene activation

  • Validate positive interactions with secondary assays

Proximity Labeling Approaches:

  • Fuse FliO to a proximity-dependent biotin ligase (e.g., BioID)

  • Express the fusion protein in bacteria

  • Supply biotin to label proteins in close proximity to FliO

  • Purify and identify biotinylated proteins by mass spectrometry

Crosslinking Mass Spectrometry:

  • Treat cells expressing FliO with chemical crosslinkers

  • Purify crosslinked complexes

  • Perform mass spectrometry analysis to identify interaction partners and specific contact sites

These methods can help elucidate FliO's interactions within the flagellar export apparatus and potentially identify novel binding partners.

How can researchers assess the impact of FliO mutations on flagellar function?

Systematic evaluation of FliO mutations requires a multi-faceted approach:

Motility Assessment:

  • Generate site-directed mutations in fliO based on predicted functional regions

  • Introduce mutations into ΔfliO backgrounds via complementation

  • Perform quantitative motility assays using soft agar plates

  • Compare motility zones of mutant strains to wild-type and ΔfliO controls

Flagellar Structure Analysis:

  • Prepare bacterial cells for transmission electron microscopy

  • Quantify the number of cells with flagella and the number of flagella per cell

  • Compare flagellation rates between wild-type (93% flagellated with 2-4 flagella) and mutants

  • Look for specific structural abnormalities in assembled flagella

Gene Expression Analysis:

  • Extract RNA from wild-type, ΔfliO, and fliO mutant strains

  • Perform qRT-PCR for RpoN-dependent (flaB, flgE) and FliA-dependent (flaA) flagellar genes

  • Compare transcript levels to assess impact on gene regulation pathways

  • Include regulatory genes (flgR, flgS, fliA, rpoN) as controls

Protein Stability Analysis:

  • Create FliO variants with epitope tags (e.g., FLAG tag)

  • Perform Western blot analysis to determine protein levels

  • Assess impact of mutations on stability of other flagellar proteins (e.g., FlhA)

This comprehensive approach allows researchers to correlate specific FliO mutations with functional outcomes, providing insights into structure-function relationships.

What is the potential for FliO as a target for antimicrobial development?

FliO represents a promising target for novel antimicrobial strategies based on several key considerations:

Essentiality for Virulence:

  • FliO is required for optimal flagellar biogenesis and bacterial motility

  • Motility is a key virulence factor for many pathogenic bacteria

  • Targeting FliO could potentially attenuate bacterial virulence without directly killing bacteria, potentially reducing selective pressure for resistance

Structural Uniqueness:

  • As the least conserved component of the flagellar export apparatus, FliO offers potential specificity for targeting particular bacterial species

  • The structural variations between species (e.g., the large N-terminal periplasmic domain in H. pylori absent in E. coli) could allow for species-selective targeting

Absence in Human Cells:

  • FliO has no human homologs, reducing the risk of off-target effects

  • This makes it a potentially safe target for therapeutic intervention

Research Approaches for Antimicrobial Development:

  • High-throughput screening of compound libraries for FliO inhibitors

  • Structure-based drug design targeting essential FliO domains

  • Peptide inhibitors designed to disrupt FliO interactions with other flagellar components

  • Identification of small molecules that destabilize FliO, reducing its half-life in bacterial cells

While preliminary research suggests promise, further studies on FliO essentiality across clinically relevant pathogens and its precise molecular mechanisms are needed.

How can researchers optimize recombinant FliO expression for structural studies?

Structural characterization of FliO presents significant challenges due to its membrane-associated nature. Optimized approaches include:

Expression System Selection:

  • Use specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Consider cell-free expression systems that can accommodate membrane proteins

  • Explore expression in eukaryotic systems (yeast, insect cells) for improved folding

Construct Optimization:

  • Test various fusion tags beyond standard His-tag (e.g., MBP, SUMO) to enhance solubility

  • Create truncated constructs based on domain boundaries to improve expression

  • Consider fusion with fluorescent proteins for expression/folding monitoring

Purification Strategy:

  • Use mild detergents appropriate for membrane proteins (DDM, LDAO, CHAPS)

  • Implement two-step purification (e.g., IMAC followed by size exclusion chromatography)

  • Maintain glycerol (5-50%) in buffers throughout purification to stabilize protein

Stabilization Approaches:

  • Screen detergent/lipid combinations to identify optimal stabilization conditions

  • Explore nanodiscs or amphipols as alternatives to detergents for membrane protein stabilization

  • Consider co-expression with interacting partners to stabilize the protein complex

Sample Quality Assessment:

  • Verify proper folding using circular dichroism spectroscopy

  • Assess homogeneity by dynamic light scattering

  • Perform limited proteolysis to identify stable domains

These optimizations can significantly improve the chances of obtaining high-quality FliO samples suitable for crystallography, cryo-EM, or NMR studies.

What are the key unanswered questions about FliO function?

Despite significant advances in understanding FliO, several important questions remain unanswered:

  • Precise Molecular Function: While FliO is known to be important for flagellar export apparatus function, its exact molecular role remains unclear. Does it serve as a structural component, a regulator, or does it have enzymatic activity?

  • Interaction Network: The complete set of proteins that interact with FliO and how these interactions contribute to flagellar assembly is not fully characterized.

  • Regulatory Mechanisms: How FliO influences flagellar gene expression, particularly of RpoN-dependent and FliA-dependent genes, requires further elucidation.

  • Species-Specific Adaptations: The functional significance of structural variations in FliO across bacterial species (particularly the N-terminal periplasmic domain in H. pylori) remains to be determined.

  • Evolutionary Conservation: Why FliO is the least conserved component of the flagellar export apparatus, and what this implies about its function or dispensability in certain contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.