Recombinant Escherichia coli Fumarate reductase subunit C (frdC)

Shipped with Ice Packs
In Stock

Description

Structure and Composition

  • Fumarate reductase consists of four subunits (FrdA, FrdB, FrdC, and FrdD) .

  • The enzyme comprises a catalytic dimer (FrdA and FrdB) and a membrane anchor domain (FrdC and FrdD) .

  • FrdA and FrdB are the large and small subunits, respectively, with molecular weights of approximately 69,000 and 25,000 daltons .

  • FrdC and FrdD are required for membrane association and the oxidation of reduced quinone analogues .

  • The catalytic dimer (69- and 27-kilodalton subunits) forms a membrane-extrinsic domain, while the 15- and 13-kd subunits form a membrane-intrinsic or anchor portion .

Function and Activity

  • Fumarate reductase serves as the terminal electron transfer enzyme in a simple electron transport chain when E. coli grows anaerobically on glycerol and fumarate .

  • The enzyme facilitates electron transport and communication between intrinsic membrane components .

  • FRD C and FRD D are essential for membrane association of fumarate reductase and for the oxidation of reduced quinone analogues .

  • The enzyme couples the tricarboxylic acid cycle and electron transport chain in bacteria .

Recombinant Production and Amplification

  • Recombinant DNA strains can increase the production of fine and commodity chemicals .

  • Recombinant strains with amplified fumarate reductase activity produce succinate from fumarate at significantly higher yields and rates than wild-type strains .

  • Amplification of both the large and small subunits of fumarate reductase occurs in recombinant strains .

  • Introducing all four fumarate reductase subunits into E. coli MI1443 is essential for restoring growth, and separation of the DNA coding for the FRD C and FRD D proteins affects the ability of fumarate reductase to assemble into a functional complex .

Role in Virulence

  • Fumarate plays a role in regulating the virulence of enterohemorrhagic Escherichia coli (EHEC) .

  • Fumarate replenishment significantly increased the virulence of the sdhA mutant toward C. elegans .

  • Fumarate regulates the expression of tryptophanase (TnaA), a downstream virulence determinant of SdhA in EHEC .

Impact of Mutations

  • Mutations in the anchor subunits can decouple fumarate reductase from electron transport .

  • Mutant cells exhibit concomitant changes in metabolomic profiles .

Comparison with Succinate Dehydrogenase

  • Fumarate reductase is distinct from succinate dehydrogenase, as it is induced anaerobically only in the presence of fumarate and is repressed during growth under aerobic conditions .

  • Succinate dehydrogenase also plays a role in cellular energetics as a member of the Krebs cycle and as complex II of the aerobic respiratory chain .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
frdC; b4152; JW4113; Fumarate reductase subunit C; Fumarate reductase 15 kDa hydrophobic protein; Quinol-fumarate reductase subunit C; QFR subunit C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-131
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
frdC
Target Protein Sequence
MTTKRKPYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKNGPEAWAGF VDFLQNPVIVIINLITLAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKSLWAVTVVA TIVILFVALYW
Uniprot No.

Target Background

Function
Escherichia coli possesses two distinct, membrane-bound, FAD-containing enzymes responsible for fumarate and succinate interconversion: fumarate reductase (anaerobic growth) and succinate dehydrogenase (aerobic growth). FrdC anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones. The QFR enzyme complex binds two quinones near the membrane; one (QP) is proximal to the [3Fe-4S] cluster (cytoplasmic side) and the other (QD, distal cluster) is on the opposite side. The functional relevance of both quinol-binding sites remains unclear.
Database Links
Protein Families
FrdC family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the structure and function of E. coli fumarate reductase subunit C (FrdC)?

    Fumarate reductase subunit C (FrdC) is one of four non-identical subunits (FrdA, FrdB, FrdC, FrdD) that comprise the fumarate reductase complex in E. coli. FrdC is a hydrophobic membrane protein of approximately 15,000 daltons that forms part of the membrane anchor domain along with FrdD (13,000 daltons) . Structurally, FrdC contains transmembrane α-helices rich in hydrophobic segments and plays a critical role in anchoring the catalytic domain (FrdA and FrdB) to the inner surface of the cytoplasmic membrane .

    Functionally, FrdC is essential for:

    • Membrane association of the fumarate reductase complex

    • Mediating electron transfer between quinones and the catalytic domain

    • Enabling the oxidation of reduced quinone analogues

    Electron microscopy has revealed that the fumarate reductase complex forms a characteristic "knob-and-stalk" structure, with FrdC (along with FrdD) forming the hydrophobic membrane anchor domain that embeds within the lipid bilayer .

  • How does the recombinant expression of FrdC affect assembly of functional fumarate reductase?

    Recombinant expression of FrdC must be carefully coordinated with other subunits to achieve functional assembly. Research has demonstrated that:

    • Introduction of all four fumarate reductase subunits into E. coli MI1443 (lacking a chromosomal frd operon) is essential for restoring anaerobic growth on glycerol and fumarate .

    • The FrdA-FrdB dimer can function in benzyl viologen oxidase assays without FrdC and FrdD, but lacks membrane association .

    • Both FrdC and FrdD are required for membrane association and for the oxidation of reduced quinone analogues .

    • Separation of the DNA coding for FrdC and FrdD affects assembly. When frdABC and frdD genes were introduced on two separate plasmid vectors into E. coli MI1443, they failed to restore anaerobic growth on glycerol and fumarate .

    This indicates that proper spatial and temporal expression of all four subunits, including FrdC, is critical for assembly of a functional complex.

  • What are the key amino acid residues in FrdC critical for electron transfer function?

    Site-directed mutagenesis studies have identified several critical amino acid residues in FrdC that are essential for electron transfer and quinone interaction:

    ResidueFunctionEffect of Mutation
    Glu-29 (FrdCE29)Deprotonation of menaquinolReplacement with Asp, Leu, Lys, or Phe has deleterious effects on both quinol oxidase and quinone reductase activities
    His-82 (FrdCH82)Stabilization of quinone radical intermediateSubstitution with Arg, Leu, Tyr, or Glu decreases menaquinol oxidase activity
    Ala-32Quinone bindingCritical for function
    Phe-38Quinone bindingCritical for function
    Trp-86Quinone bindingCritical for function
    Phe-87Quinone bindingCritical for function

    These residues are proposed to participate in a QB-type site similar to that found in photosynthetic reaction centers, with Glu-29, Ala-32, His-82, and Trp-86 of FrdC being key components .

  • How does FrdC contribute to anaerobic respiration in E. coli?

    FrdC plays a crucial role in anaerobic respiration by:

    • Facilitating the terminal electron transfer step in fumarate respiration, allowing E. coli to use fumarate instead of oxygen as a terminal electron acceptor during anaerobic growth .

    • Anchoring the fumarate reductase complex to the cytoplasmic membrane, positioning it properly for interaction with the quinone pool .

    • Participating in the oxidation of menaquinol and reduction of quinones, coupling this to the reduction of fumarate to succinate .

    • Providing a physical connection between the electron transport chain and the catalytic domain (FrdA and FrdB) where fumarate reduction occurs .

    The frd operon, which includes frdC, is regulated by the Fnr protein and is induced under anaerobic conditions while being repressed in the presence of oxygen and nitrate . This regulation ensures that fumarate reductase is expressed when needed for anaerobic respiration.

Advanced Research Questions

  • What methodologies can be employed for site-directed mutagenesis of FrdC to study structure-function relationships?

    Several effective methodologies can be employed for site-directed mutagenesis of FrdC:

    Recombineering Approach:

    • Use λ Red recombination system for precise genetic engineering in E. coli .

    • Design linear DNA substrates (dsDNA PCR products or synthetic ssDNA oligonucleotides) with desired mutations flanked by homology regions (35-50 nucleotides) .

    • Express recombination functions in bacterial strains using either:

      • Defective λ prophage systems (like in strains listed in Table 2 of source )

      • Recombineering plasmids expressing phage recombination functions

    • Introduce linear DNA by electroporation into E. coli expressing recombination functions .

    • For selection, couple with CRISPR/Cas targeting as counter-selection to enhance recovery of recombinants .

    Multiple Mutation Strategy:
    For comprehensive structure-function studies, a systematic approach similar to that described in source can be employed:

    • Create a library of single-site mutations across FrdC focusing on predicted transmembrane regions

    • Characterize each mutant enzyme for:
      a) Quinone oxidation activity
      b) Quinone reduction activity
      c) Ability to support growth under selective conditions requiring functional enzyme

    • Use comparative analysis across multiple mutations to identify patterns and critical regions

    The results can then be correlated with structural predictions to develop models of FrdC's role in electron transfer and quinone interaction .

  • How can researchers address the challenges of expressing and purifying recombinant FrdC due to its hydrophobic nature?

    Expressing and purifying hydrophobic membrane proteins like FrdC presents several challenges. Based on successful approaches used in previous studies:

    Expression Strategies:

    • Use specialized expression strains like C43(DE3) designed for membrane protein expression .

    • Co-express with molecular chaperones to aid proper folding.

    • Express the entire frd operon rather than FrdC alone to facilitate proper complex assembly .

    • Use recombinant plasmids carrying the complete frd operon under control of a strong, inducible promoter .

    • Consider fusion tags that enhance solubility or membrane targeting.

    Purification Methods:

    • Use a recombinant DNA approach to prepare E. coli cytoplasmic membranes highly enriched in fumarate reductase .

    • Employ mild detergents like Triton X-100 for solubilization of the membrane fraction .

    • Consider purifying the entire fumarate reductase complex rather than attempting to isolate FrdC alone .

    • Use affinity chromatography with tags designed for membrane proteins.

    • Apply density gradient centrifugation for membrane fraction separation.

    Activity Preservation:

    • Monitor activity using fumarate reduction assays with appropriate electron donors like DMNH₂ .

    • Compare activities of membrane-bound vs. solubilized preparations to assess functionality .

    • Note that solubilization may restore partial activity in certain mutants that lack activity in membrane-bound state .

  • What techniques can be employed to study the interaction between FrdC and FrdD in the assembly of functional fumarate reductase?

    Several complementary techniques can be employed to study FrdC-FrdD interactions:

    Genetic Approaches:

    • Construct recombinant plasmids carrying different combinations of frd genes (frdAB, frdABC, frdABCD, etc.) to assess functional complementation in vivo .

    • Introduce the frdABC and frdD genes on separate plasmid vectors to examine the effects of physical separation on assembly .

    • Apply recombineering techniques to introduce specific mutations or domain swaps in FrdC and FrdD .

    Biochemical Methods:

    • Cross-linking studies to identify points of contact between FrdC and FrdD.

    • Co-immunoprecipitation with tagged versions of FrdC or FrdD to assess complex formation.

    • Blue native PAGE to analyze intact complexes and subcomplexes.

    Structural Analysis:

    • Electron microscopy of negatively stained membranes to visualize the "knob-and-stalk" structure of the complex .

    • Analysis of hydrophobic segments and α-helical content in FrdC and FrdD to develop models of their organization within the lipid bilayer .

    • Cryo-electron microscopy for higher resolution structural information.

    Functional Assays:

    • Assess membrane association using membrane fractionation techniques.

    • Measure quinol oxidase and quinone reductase activities to evaluate functional assembly .

    • Monitor growth under selective conditions requiring functional fumarate reductase .

  • How does the role of FrdC in E. coli differ from analogous subunits in other bacterial species?

    Comparative analysis reveals significant differences in the organization and function of FrdC-like subunits across bacterial species:

    OrganismFeatures of FrdC/AnalogFunctional Differences
    E. coliContains two hydrophobic subunits (FrdC and FrdD) with menaquinol oxidation oriented toward distal side of membrane Requires both FrdC and FrdD for membrane anchoring and quinone interaction
    Wolinella succinogenesContains diheme groups in membrane anchorUtilizes an "E pathway" for transmembrane electron transfer coupled to proton transfer
    Bacillus subtilisSQR with different organizationFunctions differently from E. coli's enzyme

    Key Evolutionary Differences:

    • E. coli QFR has the menaquinol oxidation oriented toward the distal side of the membrane, while in E. coli SQR and B. subtilis SQR, it's oriented differently .

    • W. succinogenes QFR contains a transmembrane proton transfer pathway (E pathway) that is absent in E. coli QFR .

    • In E. coli, the orientation of menaquinol oxidation requires a different mechanism for balancing protons compared to other organisms .

    These differences reflect evolutionary adaptations to specific ecological niches and metabolic requirements. The arrangement in W. succinogenes is proposed to have evolved from an aerobically living predecessor that used the enzyme as a succinate:menaquinone reductase (SQR), with the E pathway evolving to maintain electroneutrality when the organism adopted an anaerobic lifestyle .

  • What methodological approaches can be used to investigate the role of FrdC in pathogenicity and virulence regulation?

    Recent studies have highlighted connections between bacterial metabolism and virulence. Several methodological approaches can be employed to investigate FrdC's role:

    Genetic Approaches:

    • Generate frdC deletion or point mutation strains using recombineering techniques .

    • Construct complementation strains expressing wild-type or mutant FrdC.

    • Create reporter fusions (e.g., frdA'-lacZ) to monitor expression under different conditions .

    Infection Models:

    • Utilize Caenorhabditis elegans infection model to assess the impact of FrdC mutations on virulence, as demonstrated for succinate dehydrogenase (Sdh) mutations in EHEC .

    • Monitor pathogen survival and virulence in mammalian cell culture systems.

    Multi-Omic Analyses:

    • Perform metabolomic analysis to identify changes in metabolite profiles (particularly succinate and fumarate) in frdC mutants .

    • Use label-free proteomic methods to identify downstream effectors regulated by FrdC-dependent metabolism .

    • Conduct transcriptomic analysis to determine expression changes in virulence genes.

    Functional Assays:

    • Assess anaerobic growth capabilities with different electron acceptors .

    • Measure fumarate reduction activity using enzymatic assays with benzyl viologen or DMNH₂ .

    • Evaluate biofilm formation and motility as virulence-associated phenotypes.

    Metabolic Rescue Experiments:

    • Attempt to restore virulence phenotypes through metabolite supplementation (e.g., adding fumarate to frdC mutants) .

    • Examine the impact of alternative electron acceptors on virulence gene expression .

    Recent studies with EHEC demonstrated that disruption of Sdh (which converts succinate to fumarate) attenuated toxicity toward C. elegans, while fumarate replenishment restored virulence, highlighting the critical role of TCA cycle intermediates in regulating virulence .

  • How can electrochemical techniques be integrated with genetic engineering of FrdC to study electron transfer pathways?

    Integrating electrochemical techniques with genetic engineering of FrdC offers powerful approaches to study electron transfer pathways:

    Genetic Engineering Approaches:

    • Construct strains expressing wild-type or mutant FrdC, focusing on residues involved in quinone binding and electron transfer (e.g., Glu-29, His-82) .

    • Engineer the Mtr pathway (cytochrome c-based electron transfer pathway) into E. coli to allow for electronic control of redox reactions .

    • Co-express cytochrome c maturation (ccm) genes necessary for functional expression of cytochromes .

    Electrochemical Measurements:

    • Utilize chronoamperometry to measure current consumption upon fumarate addition to different genetic backgrounds .

    • Compare anodic and cathodic conditions for electron flow through FrdC and the fumarate reductase complex .

    • Measure redox potentials of different components with techniques like cyclic voltammetry.

    Integrated Analysis:

    • Create deletion strains (e.g., ΔnuoH) to eliminate competing electron flux pathways to isolate FrdC-dependent electron transfer .

    • Monitor current consumption differences between wild-type and FrdC mutant strains to quantify the contribution of specific residues to electron transfer .

    • Use heme staining to assess expression levels of cytochromes in different genetic backgrounds to control for expression differences .

    This integrated approach has revealed important insights into electron transfer pathways. For example, research has shown that cathodic-derived electrons pass through FrdABCD and SdhABCD upon fumarate addition in E. coli expressing mtrCAB, and eliminating competing electron flux into fumarate reductase allows additional cathodic electrons to enter alternative pathways .

  • What are the current approaches for resolving contradictory experimental results regarding FrdC function?

    Resolving contradictions in FrdC function requires multi-faceted approaches:

    Multi-Omic Integration:

    • Combine functional genomics, proteomics, and metabolomics to provide a comprehensive view of FrdC's role .

    • Perform metabolomic analyses to measure key metabolites like succinate and fumarate in wild-type versus mutant strains .

    • Use label-free proteomic methods to identify changes in the bacterial proteome resulting from FrdC mutations .

    Comparison of In Vivo vs. In Vitro Results:

    • Some contradictions arise from differences between membrane-bound and solubilized enzyme preparations. For example, certain FrdC mutants lack activity in membrane-bound state but retain partial activity when solubilized .

    • When encountering contradictory results, compare:

      1. Membrane-bound enzyme activity

      2. Detergent-solubilized enzyme activity

      3. In vivo growth phenotypes

    Structural Biology Approaches:

    • Obtain high-resolution crystal structures of wild-type and variant FrdC within the fumarate reductase complex to identify subtle structural changes .

    • Use these structures to rule out major conformational changes as explanations for functional differences .

    Consideration of Physiological Context:

    • Evaluate enzyme behavior under different growth conditions (aerobic/anaerobic, different carbon sources) .

    • Assess the impact of regulatory factors (e.g., Fnr protein) on frdC expression and function .

    Case Study Resolution:
    A successful example of resolving contradictions is the "E pathway hypothesis" for the diheme-containing quinol:fumarate reductase from W. succinogenes. This hypothesis reconciled apparently contradictory experimental results by proposing a pathway where electron transfer via heme groups is coupled to proton transfer via residue Glu-C180. Subsequent experiments with site-directed mutants, crystal structures, and midpoint potential measurements provided conclusive evidence supporting this hypothesis .

Experimental Techniques and Methodologies

  • What are the optimal protocols for assaying recombinant FrdC activity within the fumarate reductase complex?

    Optimal protocols for assaying recombinant FrdC activity include:

    Benzyl Viologen Oxidase Assay:

    • Suitable for measuring the activity of the FrdA-FrdB dimer independently of FrdC-FrdD .

    • Uses benzyl viologen as an artificial electron donor that can bypass the quinone interaction.

    • Importantly, this assay works even when FrdC and FrdD are absent, making it useful for distinguishing catalytic activity from membrane association.

    Menaquinol/DMNH₂ Oxidation Assay:

    • Measures the physiologically relevant activity requiring functional FrdC and FrdD subunits .

    • Uses DMNH₂ (2,3-dimethyl-1,4-naphthoquinol) as a substrate for menaquinol oxidation.

    • This assay specifically tests the ability of FrdC to facilitate electron transfer from quinols.

    • Critical for evaluating the impact of FrdC mutations on quinone interaction.

    Succinate Oxidation by Methylene Blue:

    • Independent of the diheme subunit C, making it useful for confirming the general catalytic activity of the enzyme complex .

    • Can be performed on cell homogenates or isolated enzyme preparations.

    In Vivo Growth Complementation:

    • Culture E. coli under anaerobic conditions with glycerol and fumarate as the sole carbon source and terminal electron acceptor .

    • Assess the ability of recombinant FrdC variants to restore growth in strains lacking a functional frd operon.

    • This approach provides a physiologically relevant measure of FrdC function.

    Solubilization Considerations:

    • Compare activities of membrane-bound preparations versus detergent-solubilized preparations .

    • Some FrdC mutations may affect activity differently in these two states.

    • Use mild detergents like Triton X-100 for solubilization .

    Experimental Controls:

    • Include strains expressing only FrdA-FrdB to differentiate between catalytic activity and membrane-associated electron transfer .

    • Use strains with mutations in known catalytic residues (e.g., in FrdA) as negative controls.

    • Compare activities under aerobic versus anaerobic growth conditions to account for regulation .

  • How can researchers optimize recombinant expression systems for functional studies of FrdC?

    Optimizing recombinant expression systems for FrdC requires addressing several key considerations:

    Expression Host Selection:

    • Use E. coli strains specifically designed for membrane protein expression (e.g., C43(DE3) ).

    • Consider strains lacking endogenous fumarate reductase (e.g., E. coli MI1443) for complementation studies without background activity .

    • For studies requiring anaerobic expression, select hosts capable of robust anaerobic growth.

    Vector Design Considerations:

    • Express the complete frd operon rather than FrdC alone to ensure proper complex assembly .

    • Use vectors with tunable promoters to control expression levels, as overexpression of membrane proteins can be toxic.

    • Consider temperature-sensitive plasmids for certain applications, with protocols for curing after engineering is complete .

    Expression Conditions:

    • Induce expression under anaerobic conditions to mimic the natural environment for fumarate reductase expression .

    • Control oxygen levels carefully, as oxygen represses frd operon expression .

    • Consider the impact of carbon sources and electron acceptors on expression levels:

      • Glucose can partially relieve aerobic repression of fumarate reductase

      • Nitrate represses fumarate reductase expression

      • Fumarate increases expression under anaerobic conditions

    Co-expression Strategies:

    • Co-express the cytochrome c maturation (ccm) genes if working with systems involving cytochrome c .

    • For advanced electrochemical studies, co-express components of the Mtr pathway (mtrCAB) .

    Experimental Validation:

    • Confirm proper expression and membrane localization using western blotting or membrane fractionation.

    • Verify enzymatic activity using appropriate assays (benzyl viologen oxidase, DMNH₂ oxidation).

    • Assess growth complementation under selective conditions requiring functional enzyme .

  • What genetic engineering strategies can be employed to study the coordination between FrdC and other subunits?

    Several genetic engineering strategies can effectively investigate subunit coordination:

    Operon Segregation Approach:

    • Express different components of the frd operon from separate plasmids (e.g., frdABC on one plasmid and frdD on another) to assess the impact of physical separation on complex assembly .

    • This approach revealed that separation of DNA coding for FrdC and FrdD affects the ability of fumarate reductase to assemble into a functional complex .

    Subunit Deletion Analysis:

    • Create constructs expressing different combinations of subunits (e.g., frdAB, frdABC, frdABD) to determine the minimal requirements for different activities .

    • This approach demonstrated that the FrdA-FrdB dimer is active in the benzyl viologen oxidase assay, while both FrdC and FrdD are required for membrane association and quinone-dependent activities .

    Domain Swapping:

    • Create chimeric constructs by swapping domains between FrdC and homologous proteins (e.g., SdhC from succinate dehydrogenase).

    • This can identify regions responsible for specific functions or interactions.

    Site-Directed Mutagenesis:

    • Target specific residues in FrdC that may be involved in interactions with other subunits .

    • Create libraries of single-site mutations to comprehensively map interaction surfaces.

    Reporter Fusion Strategy:

    • Create protein or operon fusions between frd genes and reporter genes (e.g., frdA'-lacZ) .

    • This approach allows monitoring of expression levels under different conditions.

    • For example, frdA'-lacZ fusions revealed that expression increases 10-fold during anaerobic versus aerobic growth .

    Recombineering for Chromosomal Modifications:

    • Use λ Red-mediated recombination to create precise modifications in the chromosomal frd operon .

    • This allows study of the native operon without the complications of plasmid copy number effects.

    • Apply CRISPR/Cas targeting as a counter-selection to enhance recovery of recombinants .

  • How can researchers investigate the structural dynamics of FrdC during electron transfer?

    Investigating the structural dynamics of FrdC during electron transfer requires specialized techniques:

    Site-Directed Spin Labeling (SDSL) and Electron Paramagnetic Resonance (EPR):

    • Introduce cysteine residues at strategic positions in FrdC for attachment of spin labels.

    • Monitor conformational changes during electron transfer using EPR spectroscopy.

    • This approach can detect subtle movements within the protein structure.

    Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Compare hydrogen-deuterium exchange rates in FrdC under different redox conditions.

    • Regions involved in conformational changes typically show altered exchange rates.

    • This technique can provide a detailed map of dynamic regions during electron transfer.

    Fluorescence Resonance Energy Transfer (FRET):

    • Introduce fluorophore pairs at key positions in FrdC and partner subunits.

    • Monitor distance changes during enzyme turnover by measuring FRET efficiency.

    • This approach can provide real-time information on dynamic movements.

    Redox-Dependent Crosslinking:

    • Introduce cysteine pairs at positions predicted to move relative to each other.

    • Monitor crosslinking efficiency under different redox conditions.

    • Changes in crosslinking patterns can reveal conformational dynamics.

    Molecular Dynamics Simulations:

    • Develop computational models of FrdC based on structural data.

    • Simulate the effects of electron transfer on protein dynamics.

    • Validate computational predictions with experimental data.

    Multiconformer Continuum Electrostatic Calculations:

    • Similar to those performed for Wolinella succinogenes QFR .

    • These calculations can identify residues that undergo conformational changes and protonation upon reduction of electron carriers.

    • For example, such calculations supported the role of Glu-C180 in W. succinogenes, which undergoes a combination of conformational change and protonation upon heme reduction .

    X-ray Crystallography of Trapped Intermediates:

    • Attempt to crystallize FrdC within the fumarate reductase complex under different redox conditions.

    • Compare structures to identify conformational changes associated with electron transfer.

    • This approach successfully revealed structural details of W. succinogenes QFR variants at 2.19 Å and 2.76 Å resolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.