Recombinant Escherichia coli Fumarate reductase subunit D (frdD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
frdD; b4151; JW4112; Fumarate reductase subunit D; Fumarate reductase 13 kDa hydrophobic protein; Quinol-fumarate reductase subunit D; QFR subunit D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
frdD
Target Protein Sequence
MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVMILLVGILLPLGLFPGDALSYERVLAFAQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTLIGVVTI
Uniprot No.

Target Background

Function

Two distinct, membrane-bound, FAD-containing enzymes catalyze the interconversion of fumarate and succinate: fumarate reductase (used in anaerobic growth) and succinate dehydrogenase (used in aerobic growth). Fumarate reductase subunit D (FrdD) anchors the catalytic components of the fumarate reductase complex to the inner cell membrane and binds quinones. The enzyme complex binds two quinones near the membrane; one (QP) proximal to the [3Fe-4S] cluster on the cytoplasmic side, and another (QD) distal cluster on the opposite side of the membrane. The functional relevance of both quinol-binding sites remains unclear.

Database Links
Protein Families
FrdD family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of E. coli fumarate reductase and how does frdD fit within it?

E. coli fumarate reductase is a membrane-bound enzyme complex comprising four distinct subunits in a 1:1:1:1 stoichiometry. The enzyme consists of two catalytic subunits (flavoprotein and iron-sulfur protein) and two membrane anchor proteins, including frdD. The complete subunit composition is:

  • Flavoprotein (FrdA): 66,052 Da

  • Iron-sulfur protein (FrdB): 27,092 Da

  • Anchor protein (FrdC): 15,000 Da

  • Anchor protein (FrdD): 14,000 Da

The frdD subunit functions primarily as a hydrophobic membrane anchor, facilitating the association of the soluble catalytic components (FrdA and FrdB) with the cytoplasmic membrane. This membrane integration is critical for the enzyme's stability and for its proper positioning within the electron transport chain. Without the anchor proteins FrdC and FrdD, the enzyme exists as a soluble but less stable two-subunit form .

How does fumarate reductase differ from succinate dehydrogenase in E. coli?

Despite catalyzing the same reaction in opposite directions, fumarate reductase and succinate dehydrogenase in E. coli are distinct enzymes encoded by separate genetic loci with notable differences in structure, regulation, and kinetic properties:

PropertyFumarate reductaseSuccinate dehydrogenaseNotes
Genetic loci (min)frdA-D, 92.8sdhCDAB, 16Genetically independent enzymes
RegulationRepressed by aerobiosis and NO₃⁻; Induced by anaerobiosisRepressed by anaerobiosis; Induced by aerobiosisOpposite regulatory patterns
Km for fumarate (μM)17450Much higher affinity for fumarate
Km for succinate (μM)1,000260Lower affinity for succinate
Em7 (mV) for HiPIP-type center-60+100Different redox potentials

These enzymes likely arose from a gene duplication event followed by specialized evolution to serve different metabolic roles - fumarate reductase for anaerobic respiration using fumarate as terminal electron acceptor and succinate dehydrogenase for aerobic respiration within the TCA cycle .

What is the genetic organization of the frd operon in E. coli?

The fumarate reductase genes in E. coli are arranged as a single operon consisting of a promoter-operator region, four cistrons (frdA, frdB, frdC, and frdD), and a transcriptional terminator. The complete nucleotide sequence of this operon has been determined, with frdD encoding the smallest of the four subunits at 14,000 Da .

The operon structure ensures coordinated expression of all four subunits under appropriate regulatory conditions, primarily during anaerobic growth when fumarate is available as a terminal electron acceptor. The operon is subject to repression under aerobic conditions and in the presence of nitrate, while being induced under anaerobic conditions. This regulatory pattern ensures the enzyme is produced only when functionally beneficial for the organism's metabolism .

What are the main challenges in recombinant expression of E. coli fumarate reductase subunit D?

Recombinant expression of frdD presents several significant challenges due to its nature as a small, hydrophobic membrane protein:

  • Membrane integration: As an integral membrane protein, frdD requires proper insertion into lipid bilayers for structural stability and function. Expression systems must facilitate appropriate membrane targeting and integration .

  • Complex assembly: FrdD functions as part of a four-subunit complex. Expressing it in isolation may lead to improper folding or aggregation without its partner subunits, particularly FrdC (the other anchor protein) .

  • Solubility issues: The highly hydrophobic nature of frdD makes it prone to aggregation when overexpressed, potentially forming inclusion bodies that complicate purification and functional characterization .

  • Stability concerns: When isolated from its native complex, frdD tends to be less stable. Research has shown that the four-subunit form of fumarate reductase is significantly more stable than partial complexes or isolated subunits .

  • Expression balance: When the frdA and frdB subunits are overexpressed, they can accumulate in soluble form after membrane sites are saturated. This suggests that balanced expression of all subunits is crucial for proper complex assembly and membrane association .

These challenges necessitate specialized approaches for successful recombinant production of functional frdD, including co-expression strategies with other fumarate reductase subunits and optimization of membrane protein expression systems.

How can researchers optimize membrane association of recombinant fumarate reductase in E. coli?

Optimizing membrane association of recombinant fumarate reductase requires addressing several factors:

  • Co-expression of anchor subunits: Studies have demonstrated that two hydrophobic polypeptides (FrdC and FrdD) are necessary for the soluble two-subunit form of fumarate reductase to become properly associated with the membrane. Any recombinant expression strategy should ensure balanced production of these anchor proteins .

  • Amplification strategies: Several methods have been developed for amplification of fumarate reductase, including:

    • Gene dosage effects using chromosomal duplication mutants

    • Replicating λfrd phages

    • Multicopy hybrid plasmids

  • Membrane site availability: Research has shown that when fumarate reductase is extensively overproduced, it can saturate available membrane sites, leading to accumulation of soluble forms of the enzyme. This suggests either that anchor polypeptides are not amplified to the same extent as the catalytic subunits, or that membrane sites themselves become limiting factors .

  • Detergent selection: For purification and characterization purposes, appropriate detergents like Triton X-100 have been successfully used for solubilization while maintaining the integrity of the four-subunit complex. The purification procedure using sucrose density gradient centrifugation after detergent solubilization results in a more stable enzyme form that more closely resembles the native membrane-bound activity .

Balanced expression of all four subunits and careful consideration of membrane capacity are crucial for optimal membrane association of recombinant fumarate reductase.

What methods are effective for isolating intact fumarate reductase complexes with functional frdD?

Isolating intact fumarate reductase complexes with functional frdD requires techniques that preserve the integrity of membrane protein complexes:

  • Membrane fraction preparation: Initial separation of membrane fractions containing the fumarate reductase complex is typically performed by differential centrifugation following cell lysis .

  • Detergent solubilization: Triton X-100 has been successfully employed to solubilize the membrane-bound enzyme while maintaining the association of all four subunits. The choice of detergent is critical as it must effectively extract the complex from the membrane without disrupting subunit interactions .

  • Sucrose density gradient centrifugation: This technique has proven effective for purifying the four-subunit holoenzyme after detergent solubilization. The resulting preparation is more stable than the two-subunit form and more closely resembles the native membrane-bound activity .

  • Activity-based purification: Since fumarate reductase catalyzes the reduction of fumarate to succinate, activity assays can be used during purification to track functionally intact complexes. Enzyme activity can be measured using dye-linked assays .

  • Size exclusion chromatography: This technique can separate intact complexes from partial assemblies or individual subunits based on their molecular size.

The purified four-subunit complex typically exhibits greater stability and activity compared to partial complexes, highlighting the importance of maintaining all subunits, including frdD, in their native association for functional studies.

What expression systems are most suitable for producing recombinant frdD?

When designing expression systems for recombinant frdD production, researchers should consider:

The choice of expression system should be guided by the specific research questions being addressed and whether frdD is needed in isolation or as part of the intact fumarate reductase complex.

What analytical methods are most informative for characterizing recombinant frdD?

Comprehensive characterization of recombinant frdD requires multiple analytical approaches:

  • SDS-PAGE analysis: This technique allows verification of protein size and purity. For membrane proteins like frdD, special considerations for sample preparation may be needed, such as avoiding boiling the sample which can cause aggregation .

  • Western blotting: Using antibodies specific to frdD enables detection and quantification, particularly useful when expression levels are low or when tracking the protein during purification.

  • Membrane association assays: Fractionation experiments separating membrane and soluble components can assess the degree of frdD integration into membranes. Successful membrane anchor proteins should predominantly localize to membrane fractions .

  • Complex assembly analysis: Techniques like native PAGE, blue native PAGE, or size exclusion chromatography can evaluate whether frdD properly associates with other fumarate reductase subunits to form the complete enzyme complex.

  • Functional assays: Since frdD contributes to proper positioning of the catalytic subunits, enzymatic activity measurements of fumarate reduction can indirectly assess frdD functionality. Comparison of activity between membrane-bound and solubilized forms provides insight into the contribution of anchor proteins .

  • Structural characterization: Advanced techniques like cryo-electron microscopy can provide insights into how frdD positions within the complete complex and interacts with membrane lipids. This can be complemented with computational predictions of membrane protein topology.

A multi-method approach yields the most comprehensive characterization of this challenging membrane protein component.

How can researchers assess the impact of frdD mutations on fumarate reductase function?

Systematic assessment of frdD mutations requires a methodical approach combining genetic, biochemical, and functional analyses:

This combined approach enables researchers to correlate specific molecular features of frdD with its functional roles in membrane anchoring, complex stabilization, and enzymatic activity.

What strategies can improve the yield and stability of recombinant frdD during purification?

Purification of small hydrophobic membrane proteins like frdD presents significant challenges that can be addressed through several specialized approaches:

  • Co-purification strategies: Purifying frdD together with its partner subunits rather than in isolation can dramatically improve stability. The four-subunit form of fumarate reductase is known to be more stable than isolated subunits or partial complexes .

  • Optimized detergent selection: Systematic screening of different detergents beyond the commonly used Triton X-100 can identify optimal conditions for extracting frdD while maintaining native-like structure. Mild detergents or detergent mixtures often perform better for membrane protein purification .

  • Addition of stabilizing lipids: Including specific phospholipids during purification can help stabilize membrane proteins by mimicking their native lipid environment. This is particularly relevant for proteins like frdD that function at the membrane interface.

  • Reduced temperature protocols: Conducting purification steps at lower temperatures (e.g., 4°C) can minimize protein degradation and aggregation, preserving structural integrity.

  • Protease inhibitor cocktails: Using comprehensive protease inhibitor mixtures throughout the purification process protects against degradation, which is particularly important for small proteins like frdD.

  • Affinity tags with cleavable linkers: Strategic placement of affinity tags with TEV or similar protease cleavage sites can facilitate purification while allowing removal of the tag if it interferes with structure or function. For frdD, N-terminal tags are often preferable as C-terminal modifications may disrupt membrane integration .

  • Buffer optimization: Screening different buffer compositions, pH values, and ionic strengths can identify conditions that maximize stability during and after purification. For membrane proteins, including glycerol (5-10%) in buffers often improves stability.

These approaches can be combined and optimized based on specific research requirements to maximize the yield of functional frdD protein.

How can researchers develop an effective expression system for the entire fumarate reductase operon?

Developing an effective expression system for the complete fumarate reductase operon requires careful consideration of several factors:

  • Operon integrity: Maintaining the natural organization of the frdABCD genes in the expression construct preserves native spacing and potential translational coupling, which can be critical for balanced expression of all four subunits .

  • Inducible control: Utilizing tightly regulated inducible promoters allows precise control over expression timing and level, which is important for membrane proteins that can be toxic when overexpressed. Systems based on T7 RNA polymerase with lac operator control provide excellent tunability .

  • Copy number considerations: Medium to low copy number plasmids often perform better for membrane protein expression than high copy plasmids. Alternatively, chromosomal integration ensures stable copy number and reduces metabolic burden .

  • Environmental regulation: Since the native fumarate reductase is expressed under anaerobic conditions and repressed aerobically, incorporating oxygen-responsive regulatory elements can mimic natural expression patterns. Anaerobic induction may improve proper assembly and membrane integration .

  • Codon optimization: Analyzing and optimizing codon usage for each gene in the operon can improve translation efficiency while maintaining appropriate relative translation rates between subunits.

  • Appropriate host selection: E. coli strains specifically designed for membrane protein expression or those with reduced protease activity can improve yields of intact complexes. For functional studies, using strains with deletions in the native frd operon prevents interference from endogenous proteins .

  • Detection strategies: Incorporating non-interfering reporter tags on specific subunits can facilitate monitoring of expression and purification without compromising function. For example, a small epitope tag on FrdA can track the catalytic domain while minimizing disruption of membrane anchoring by FrdC and FrdD .

Implementation of these strategies has enabled successful amplification of fumarate reductase using chromosomal duplication mutants, replicating λfrd phages, and multicopy hybrid plasmids .

What are the most common problems encountered in recombinant frdD expression and how can they be resolved?

Researchers frequently encounter several challenges when working with recombinant frdD, each requiring specific troubleshooting approaches:

These troubleshooting approaches address the common challenges in working with frdD while recognizing its role within the larger fumarate reductase complex.

How can researchers evaluate whether recombinant frdD is properly integrated into the membrane?

Confirming proper membrane integration of recombinant frdD requires multiple complementary approaches:

  • Subcellular fractionation: Separate membrane and soluble fractions using ultracentrifugation and analyze the distribution of frdD between fractions. Properly integrated frdD should predominantly appear in membrane fractions .

  • Detergent extractability: Test extraction efficiency with different detergents. Integral membrane proteins like frdD require detergents for solubilization from membranes, whereas peripheral membrane proteins or misfolded aggregates show different solubilization patterns.

  • Protease accessibility assays: Treat intact membrane vesicles with proteases like trypsin or proteinase K. Properly inserted membrane proteins show a characteristic protection pattern where only exposed domains are digested, while transmembrane segments remain protected.

  • Membrane flotation assays: Mix protein samples with sucrose or other density gradient components and perform ultracentrifugation. Membrane-associated proteins float with lipid vesicles to lower density regions of the gradient.

  • Functional complex assembly: Assess whether frdD can associate with other fumarate reductase subunits to form enzymatically active complexes. The formation of a functional complex with catalytic activity strongly suggests proper membrane integration of the anchor subunits .

  • Microscopy techniques: For cell-based studies, fluorescently tagged frdD can be visualized using confocal microscopy to confirm membrane localization. The pattern should show peripheral cellular distribution consistent with membrane localization.

  • Enzymatic activity in membrane fractions: Measure fumarate reductase activity in isolated membrane fractions. Proper integration of frdD and frdC anchor proteins should result in membrane-associated enzymatic activity .

These approaches collectively provide strong evidence for proper membrane integration when consistent results are observed across multiple methods.

How might synthetic biology approaches enhance recombinant frdD production and applications?

Synthetic biology offers innovative strategies to overcome traditional challenges in frdD expression and expand its research applications:

  • Minimal synthetic operons: Engineering streamlined versions of the frd operon with optimized regulatory elements and spacing can improve expression efficiency while maintaining proper subunit stoichiometry. This approach reduces genetic complexity while preserving essential functional elements .

  • Orthogonal translation systems: Implementing specialized ribosomes and tRNAs dedicated to membrane protein synthesis could improve frdD expression by reducing competition with host proteins for translation machinery, particularly beneficial for proteins with rare codons or complex folding requirements.

  • Artificial membrane environments: Developing synthetic lipid compositions or nanodiscs optimized for fumarate reductase stability and activity can enhance both production yields and functional studies. These controlled environments can stabilize the protein outside its native membrane context.

  • Cell-free expression systems: Utilizing cell-free protein synthesis platforms specifically optimized for membrane proteins bypasses many cellular limitations and toxic effects associated with membrane protein overexpression. These systems allow rapid prototyping of expression constructs and direct incorporation into artificial membranes .

  • Modular protein engineering: Creating chimeric proteins where domains of frdD are fused with well-expressed membrane proteins could improve expression and provide insights into structure-function relationships. This approach has been successful for other challenging membrane proteins.

  • Directed evolution: Applying high-throughput screening or selection methods to identify frdD variants with enhanced expression, stability, or activity can generate improved proteins for research applications and potentially discover novel functional properties.

  • Biosensor applications: Engineering frdD-containing complexes as electrochemical biosensors for fumarate detection represents an emerging application area, leveraging the protein's natural electron transfer capabilities in new technological contexts.

These approaches demonstrate how synthetic biology can both improve production of challenging proteins like frdD and expand their potential applications beyond traditional research contexts.

What can researchers learn from comparing fumarate reductases across different bacterial species?

Comparative analysis of fumarate reductases across bacterial species provides valuable insights into evolution, structure-function relationships, and potential biotechnological applications:

  • Evolutionary adaptation: Comparing fumarate reductases from diverse bacteria reveals how these enzymes have adapted to different ecological niches and metabolic requirements. Some species rely heavily on fumarate respiration, leading to specialized enzyme properties, while others maintain it as a secondary pathway .

  • Structural conservation and divergence: Analysis of frdD homologs across species can identify highly conserved regions likely critical for function versus variable regions representing species-specific adaptations. This information guides rational mutagenesis studies and helps predict functional consequences of genetic variations.

  • Membrane integration strategies: Different bacterial species may employ varied approaches for anchoring fumarate reductase to membranes. Comparing these strategies provides insights into membrane protein evolution and potentially reveals more efficient anchoring mechanisms that could be applied to recombinant expression systems .

  • Redox potential tuning: The iron-sulfur centers in fumarate reductases show species-specific variations in redox potentials, which influence electron transfer efficiency. Understanding how different bacteria tune these properties offers insights for engineering enzymes with altered activities .

  • Substrate specificity differences: While E. coli fumarate reductase is relatively specific, homologs from other bacteria may accept alternative substrates. Comparative analysis can identify determinants of substrate preference, potentially enabling engineering of enzymes with novel catalytic capabilities.

  • Regulatory diversity: The regulation of fumarate reductase expression varies across bacterial species, reflecting their metabolic needs. Studying these different regulatory strategies provides insights into bacterial adaptation and may reveal superior regulatory elements for recombinant expression systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.