Recombinant Escherichia coli Glutamate/aspartate transport system permease protein gltJ (gltJ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
gltJ; b0654; JW0649; Glutamate/aspartate import permease protein GltJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
gltJ
Target Protein Sequence
MSIDWNWGIFLQQAPFGNTTYLGWIWSGFQVTIALSICAWIIAFLVGSFFGILRTVPNRF LSGLGTLYVELFRNVPLIVQFFTWYLVIPELLPEKIGMWFKAELDPNIQFFLSSMLCLGL FTAARVCEQVRAAIQSLPRGQKNAALAMGLTLPQAYRYVLLPNAYRVIVPPMTSEMMNLV KNSAIASTIGLVDMAAQAGKLLDYSAHAWESFTAITLAYVLINAFIMLVMTLVERKVRLP GNMGGK
Uniprot No.

Target Background

Function
GltJ is a component of the ABC transporter complex GltIJKL involved in glutamate and aspartate uptake. It is believed to be responsible for translocating the substrate across the membrane. Regarding microbial infection, it is likely that GltJ transports the toxic C-terminal region of CdiA from the P. luminescens strain TTO1 across the inner membrane into the cytoplasm, where CdiA exerts its toxic effects. This toxin transport is strain-specific, and mutations in this gene do not confer resistance to various other tested CdiA toxins.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the glutamate/aspartate transport system permease protein GltJ and what is its function in E. coli?

The glutamate/aspartate transport system permease protein GltJ is a membrane-bound component of the ABC (ATP-binding cassette) transport system in E. coli that facilitates the import of glutamate and aspartate amino acids across the bacterial cell membrane. As a permease protein, GltJ forms part of the transmembrane domain of this transport complex, creating a pathway through which these amino acids can traverse the phospholipid bilayer. The complete transport system typically consists of a substrate-binding protein, two permease proteins (including GltJ), and an ATP-binding protein that provides energy for the transport process through ATP hydrolysis. This system is crucial for bacterial nitrogen metabolism and amino acid homeostasis.

What are the challenges associated with recombinant expression of membrane proteins like GltJ?

Recombinant expression of membrane proteins like GltJ presents several significant challenges:

  • Membrane proteins often exhibit toxicity to host cells when overexpressed, leading to growth inhibition and reduced yields

  • Proper folding requires insertion into the membrane, which can become saturated when protein is overexpressed

  • The hydrophobic nature of transmembrane domains can lead to aggregation and inclusion body formation

  • Post-translational modifications may be required for proper function

  • The native E. coli environment includes specific lipid compositions that may affect protein folding and function

These challenges stem from the general burden of recombinant protein expression on host metabolism. Excessive amounts of exogenous mRNA may outcompete endogenous mRNA, impairing host protein synthesis and ultimately cell viability. This can lead to the selection of mutants with decreased expression capabilities, particularly when using T7 RNA polymerase-based systems with high IPTG concentrations (>0.1 mM) .

What expression systems are commonly used for producing recombinant GltJ protein?

Expression SystemKey FeaturesAdvantagesLimitations
pET SystemT7 promoter, IPTG inductionHigh expression levels, tight regulationPotential toxicity, leaky expression
pBAD SystemArabinose-inducible promoterFine-tuning of expression, less leakyLower expression levels than pET
BL21-AI gp2 SystemDecouples cell growth from protein productionReduced toxicity, tunable expressionMore complex setup
C41/C43(DE3) StrainsMutated BL21(DE3) derivativesBetter tolerance of toxic membrane proteinsMutations may affect protein quality
Lemo21(DE3) SystemT7 lysozyme co-expressionTunable expression levelAdditional antibiotic needed

For membrane proteins like GltJ, the BL21-AI gp2 system offers significant advantages as it allows cell growth to be decoupled from recombinant protein production through the expression of a phage-derived inhibitor peptide that blocks E. coli RNA polymerase but not T7 RNA polymerase . This approach contradicts the theory that inhibition of host metabolism causes bacterial decline, suggesting instead that metabolite shortages might limit recombinant expression.

How should pilot experiments be designed for optimizing GltJ expression?

Designing effective pilot experiments for GltJ expression requires a methodical approach that accounts for multiple variables:

  • Establish clear objectives for the pilot experiment (e.g., optimal induction conditions, best expression strain)

  • Select critical parameters to investigate (temperature, inducer concentration, time, media composition)

  • Implement a low-discrepancy design with respect to a target distribution to efficiently explore the parameter space

  • Include appropriate controls for background expression and toxicity assessment

  • Utilize small-scale cultures before scaling up to conserve resources

Unlike simple proteins, membrane proteins like GltJ require consideration of additional factors such as membrane insertion efficiency and functionality after insertion. This creates a more complex optimization problem that can benefit from systematic experimental design approaches used in generalized linear models (GLMs) . Since the design criterion depends on multiple specifications (e.g., induction parameters, strain characteristics), a carefully structured pilot experiment provides crucial insights that guide subsequent optimization steps.

What quantitative and qualitative methods should be combined when studying GltJ function?

A comprehensive study of GltJ function requires both quantitative and qualitative approaches:

Quantitative Methods:

  • Transport assays measuring uptake rates of radiolabeled glutamate/aspartate

  • Binding affinity measurements using techniques like isothermal titration calorimetry

  • Protein expression level quantification via Western blotting and densitometry

  • Cell growth rate measurements to assess metabolic burden

Qualitative Methods:

  • Immunofluorescence microscopy to determine subcellular localization

  • Protein-protein interaction studies to identify binding partners

  • Structure-function relationship studies through mutagenesis

  • Phenotypic assessment of knockout/complementation strains

This mixed-method approach is particularly valuable for complex questions about GltJ function, such as determining how specific mutations affect both transport kinetics (quantitative) and protein stability/localization (qualitative) . Quantitative methods provide precise measurements with larger sample sizes that can be generalized, while qualitative methods offer deeper insights into mechanisms and contextual factors with smaller, more focused samples.

How can disulfide bond formation be optimized when expressing GltJ protein?

Optimizing disulfide bond formation in GltJ expression requires addressing several factors:

  • Select expression strains engineered for enhanced disulfide bond formation:

    • Origami™ strains (mutations in thioredoxin reductase and glutathione reductase)

    • SHuffle® strains (expressing cytoplasmic DsbC)

  • Modify growth conditions to promote proper oxidative environment:

    • Lower incubation temperature (16-25°C) to slow folding

    • Include oxidizing agents in the medium

    • Maintain optimal pH for disulfide bond formation

  • Co-express helper proteins that facilitate disulfide bond formation:

    • DsbA and DsbC (disulfide bond isomerases)

    • Protein disulfide isomerase (PDI)

    • Sulfhydryl oxidases

  • Optimize extraction and purification conditions to preserve disulfide bonds:

    • Include appropriate redox buffers

    • Avoid reducing agents when not necessary

    • Monitor disulfide status throughout purification

The formation of correct disulfide bonds is one of the known bottlenecks in recombinant protein expression in E. coli, and recent advances have improved the reliability of producing proteins whose folding depends on these bonds . For membrane proteins like GltJ, the reducing environment of the E. coli cytoplasm traditionally presents a challenge for disulfide bond formation, making the choice of expression compartment and strain particularly important.

What strategies can mitigate metabolic burden during high-level expression of GltJ?

Mitigating metabolic burden during GltJ expression involves several strategic approaches:

  • Tightly regulate expression levels:

    • Use lower concentrations of inducer (<0.1 mM IPTG for T7 systems)

    • Implement auto-induction systems for gradual protein production

    • Consider tunable expression systems like Lemo21(DE3)

  • Optimize growth conditions:

    • Enrich media with amino acids to reduce biosynthetic demands

    • Maintain optimal oxygen levels for energy production

    • Control growth rate through temperature modulation

  • Balance protein synthesis with cell growth:

    • Use biphasic expression protocols (grow first, then induce)

    • Implement fed-batch processes to maintain nutrient availability

    • Consider the BL21-AI gp2 system that decouples growth from expression

  • Monitor culture health:

    • Track growth curves for signs of metabolic stress

    • Assess plasmid stability over time

    • Measure cellular response indicators (stress proteins)

The metabolic burden of recombinant protein production remains a complex issue with sometimes contradictory experimental results. Excessive amounts of exogenous mRNA can outcompete endogenous mRNA, impairing host protein synthesis and ultimately cell viability, leading to selective pressure that favors cells with mutations reducing expression capability . For membrane proteins like GltJ, this burden is often exacerbated by the additional stress of membrane insertion.

How can researchers address contradictions in experimental data when studying GltJ transport kinetics?

Resolving contradictions in GltJ transport kinetics data requires a systematic approach:

  • Categorize contradictions using the (α, β, θ) notation:

    • α: Number of interdependent items (e.g., substrate concentration, pH, temperature)

    • β: Number of contradictory dependencies identified

    • θ: Minimal number of Boolean rules needed to assess contradictions

  • Implement a structured evaluation method:

    • Map the specific dependencies between variables

    • Identify impossible or contradictory value combinations

    • Apply Boolean minimization to reduce complexity

  • Apply domain-specific knowledge to resolve contradictions:

    • Differentiate between biological variability and measurement error

    • Consider context-dependent factors that might explain differences

    • Evaluate methodological differences between contradictory studies

  • Develop a unified model that accommodates apparent contradictions:

    • Incorporate conditional dependencies

    • Account for non-linear relationships

    • Consider threshold effects

For example, contradictory findings about GltJ substrate affinity might form a (3,4,2) contradiction pattern, where three interdependent factors (pH, temperature, membrane composition) yield four apparently contradictory results that can be resolved with two Boolean rules . This structured approach helps handle multidimensional interdependencies and provides a framework for implementing contradiction assessment tools.

What statistical approaches are most appropriate for analyzing GltJ structure-function relationships?

Statistical ApproachApplication to GltJ ResearchAdvantagesLimitations
Multiple Linear RegressionCorrelating structural modifications with transport ratesHandles multiple variablesAssumes linear relationships
Principal Component AnalysisIdentifying key structural determinants of functionReduces dimensionalityInterpretability challenges
Hierarchical ClusteringGrouping similar mutants based on functional profilesReveals natural groupingsSensitive to distance metric choice
Bayesian Network AnalysisModeling causal relationships between structure and functionHandles uncertaintyRequires prior knowledge
Machine Learning ModelsPredicting functional outcomes of mutationsCan capture complex patternsRisk of overfitting with limited data

When analyzing structure-function relationships for membrane proteins like GltJ, mixed statistical models are often most appropriate because they can integrate both quantitative measurements (transport rates, binding affinities) and qualitative observations (localization patterns, stability assessments) . The experimental design should follow principles of low-discrepancy with respect to the target distribution to ensure efficient exploration of the parameter space .

How does glycosylation affect GltJ function when expressed in engineered E. coli systems?

Although E. coli naturally lacks sophisticated glycosylation machinery, recent advances have improved glycosylation pathways for recombinant proteins . For GltJ, which is not naturally glycosylated in E. coli, engineered glycosylation can:

  • Improve protein stability through enhanced folding:

    • N-linked glycosylation can stabilize specific protein conformations

    • Glycans can shield hydrophobic regions from aggregation

  • Affect transport kinetics:

    • Glycan modifications near substrate binding sites may alter affinity

    • Conformational changes induced by glycosylation can impact transport rates

  • Influence protein-protein interactions:

    • Modified interaction with other components of the transport system

    • Altered recognition by native regulatory proteins

  • Change membrane topology:

    • Glycans in extracellular loops can affect membrane positioning

    • Altered interactions with membrane lipids

Experimental approaches to study these effects include:

  • Comparing transport activities between glycosylated and non-glycosylated variants

  • Structural analysis using techniques like hydrogen-deuterium exchange mass spectrometry

  • Molecular dynamics simulations to predict glycan impacts on protein movement

The implementation of glycoengineered E. coli strains represents a significant advance in addressing one of the known bottlenecks in recombinant expression , offering new possibilities for studying post-translationally modified membrane transport proteins like GltJ.

What are the most effective approaches for studying GltJ in native-like membrane environments?

Studying GltJ in native-like membrane environments requires sophisticated approaches:

  • Nanodiscs and lipid bilayer systems:

    • Reconstitution into nanodiscs with specific lipid compositions

    • Planar lipid bilayers for electrophysiological measurements

    • Giant unilamellar vesicles (GUVs) for microscopy studies

  • Advanced functional assays:

    • Solid-supported membrane electrophysiology

    • Single-molecule fluorescence resonance energy transfer (smFRET)

    • Fluorescence correlation spectroscopy for diffusion measurements

  • Structural biology in membrane mimetics:

    • Cryo-electron microscopy of GltJ in various conformational states

    • Solid-state NMR in lipid bilayers

    • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Computational approaches:

    • Molecular dynamics simulations in explicit membrane environments

    • Coarse-grained modeling for long-timescale processes

    • Quantum mechanics/molecular mechanics for transport mechanisms

These methodologies help address the fundamental challenge of studying membrane proteins like GltJ, which require a lipid environment for proper folding and function. The goal is to minimize artifacts introduced by detergent solubilization or non-native membrane compositions, which can significantly alter transport kinetics and protein behavior . By combining multiple complementary approaches, researchers can develop a more complete understanding of GltJ function in its native context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.