Recombinant Escherichia coli Glutamate/aspartate transport system permease protein gltK (gltK)

Shipped with Ice Packs
In Stock

Description

Domain Architecture

  • Predicted periplasmic, transmembrane, and cytoplasmic regions .

  • Critical C-terminal domain for effector protein translocation (e.g., BcpA-2-CT in Burkholderia multivorans) .

Role in Transport

  • Forms the GltJK complex with GltJ, facilitating glutamate/aspartate uptake across the cytoplasmic membrane .

  • Required for translocation of contact-dependent inhibition (CDI) effectors in Burkholderia and E. coli .

Adhesion Complex Participation

  • Integrates into the GltABHK-CglB complex in bacterial focal adhesions:

    • Binds outer membrane (OM) porins GltA and GltB, enabling surface exposure of adhesin CglB .

    • Stabilizes OM complex via β-sheet interactions with GltA/B and direct contact with CglB’s β-propeller domain .

Key Findings from Recent Studies

  • Structural Modeling: AlphaFold predictions reveal GltK’s localization on the external face of OM porins, contradicting earlier assumptions of periplasmic localization .

  • Species Specificity:

    • B. multivorans GltJK cannot be functionally replaced by E. coli homologs due to C-terminal sequence divergence (71% identity insufficient for cross-species effector uptake) .

  • Force Transduction: GltK mediates mechanical linkage between cytoplasmic motor proteins (MreB, AglZ) and OM adhesins, enabling gliding motility .

Future Research Directions

  • Mechanistic Studies: Resolve atomic-level interactions between GltK and OM porins using cryo-EM.

  • Therapeutic Targeting: Explore gltK’s role in biofilm formation for antibiotic development.

  • Synthetic Biology: Engineer chimeric GltJK complexes for controlled effector delivery in biomanufacturing .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preferred format in the order notes for tailored preparation.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for accurate delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing it accordingly.
Synonyms
gltK; b0653; JW0648; Glutamate/aspartate import permease protein GltK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
gltK
Target Protein Sequence
MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYV NVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGI QSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADF FRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex GltIJKL, which is involved in glutamate and aspartate uptake. It is believed to be responsible for the translocation of the substrate across the membrane.

In the context of microbial infections, this protein likely transports the toxic C-terminal region of CdiA from P.luminescens strain TTO1 across the inner membrane to the cytoplasm, where CdiA exerts its toxic effects. Notably, toxin transport is strain-specific, and mutations in this gene do not confer resistance to various other tested CdiA toxins.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the glutamate/aspartate transport system permease protein gltK in E. coli?

The glutamate/aspartate transport system permease protein gltK is a component of the ABC transporter system in Escherichia coli responsible for the uptake of glutamate and aspartate. It functions as part of a multiprotein complex that spans the bacterial membrane and facilitates the active transport of these amino acids into the cell. The protein belongs to the broader solute carrier (SLC) superfamily, which plays crucial roles in maintaining cellular nutrient and metabolite homeostasis . Studies of such transport proteins are essential for understanding bacterial metabolism and potential targets for therapeutic interventions.

How does gltK function within the ABC transporter system?

The gltK protein functions as a transmembrane permease component of the glutamate/aspartate ABC transporter. Within this system, gltK forms part of the transmembrane domain that creates a pathway through which the substrates (glutamate and aspartate) can cross the cell membrane. This transport process typically involves substrate recognition by a periplasmic binding protein (similar to the glucose-binding protein described in search result ), followed by interaction with the permease components like gltK, and is driven by ATP hydrolysis via the ATP-binding components of the transporter complex. The periplasmic binding proteins undergo conformational changes upon substrate binding, which then triggers interactions with the transmembrane domains to facilitate substrate translocation across the membrane .

What expression systems are commonly used for recombinant gltK production?

Recombinant gltK is typically produced using E. coli expression systems, similar to other membrane proteins. Common expression vectors include pET series vectors (such as pET22b mentioned in search result ), which place the target gene under the control of strong promoters like T7. Expression hosts typically include E. coli strains optimized for protein production such as BL-21(DE3) . When expressing membrane proteins like gltK, researchers must consider factors such as potential toxicity to the host cell, proper membrane insertion, and the metabolic stress response that can occur with overexpression of recombinant proteins, which often leads to decreased growth and product formation rates .

What challenges are commonly encountered when expressing recombinant gltK?

Expression of recombinant membrane proteins like gltK often presents several challenges. Over-expression of recombinant proteins in E. coli typically triggers a metabolic stress response that causes a sharp decline in both growth and product formation rates after induction . This stress can be particularly pronounced with membrane proteins due to limited membrane space and potential toxicity. Additionally, proper folding and membrane insertion of gltK can be problematic. Similar to what was observed with other recombinant proteins, researchers might need to optimize growth conditions, consider co-expression with chaperones, or engineer the host strain to alleviate stress responses, as was done with glycerol kinase (glpK) in search result , where "co-expression of glpK improved the expression levels of rhIFN-β in glycerol containing medium" .

How can one optimize recombinant gltK expression to mitigate metabolic stress?

Optimizing recombinant gltK expression requires a multifaceted approach that addresses the metabolic stress response. Based on research with other recombinant proteins in E. coli, up-regulation of certain substrate utilization genes can help alleviate this stress response. For instance, one applicable strategy might be similar to that used for improving recombinant interferon-β expression, where co-expression of the glycerol kinase (glpK) gene significantly improved protein yield . For gltK specifically, researchers might consider:

  • Identifying key down-regulated genes during gltK overexpression via transcriptomic analysis

  • Co-expressing these identified genes to improve cellular metabolism

  • Engineering modified E. coli strains with chromosomal insertion of supportive genes under stress-responsive promoters

  • Implementing fed-batch cultivation strategies with optimized media composition

In high-density fed-batch cultures, exponential feeding of complex substrates can be utilized to increase biomass and consequently improve product titers. This approach, when combined with genetic modifications (such as inserting supportive genes downstream of stress-responsive promoters like ibpA), has shown significant improvements in both growth and expression levels for other recombinant proteins .

What methods can be used to assess gltK transport function without radioactive substrates?

Traditional transport assays for membrane transporters like gltK have relied heavily on radioactive substrates, which present hazards and require special handling. Recent advances offer alternative approaches that can be applied to gltK research. A promising alternative is to use stable isotope-labeled compounds as substrates with detection by liquid chromatography-tandem mass spectrometry (LC-MS/MS) . This approach offers several advantages:

  • Non-radioactivity and reduced hazards

  • Lower cost compared to radiolabeled substrates

  • Non-toxicity and easier accessibility

  • Simple integration with existing LC-MS/MS bioanalytical workflows

For gltK specifically, researchers could utilize stable isotope-labeled glutamate or aspartate as substrates to measure transport activity. The assay would involve:

  • Expressing recombinant gltK in appropriate host cells

  • Incubating cells with isotope-labeled substrates under controlled conditions

  • Washing cells to remove extracellular substrate

  • Extracting intracellular contents

  • Analyzing the internalized labeled substrate via LC-MS/MS

This approach circumvents the limitations of radioligand uptake assays while providing quantitative, reliable measurements of transport function .

How do mutations in gltK affect substrate specificity and transport kinetics?

Mutations in gltK can significantly impact both substrate specificity and transport kinetics. While specific data for gltK mutations are not provided in the search results, principles from similar transport proteins suggest several approaches for investigation:

  • Site-directed mutagenesis targeting key residues in substrate binding pockets

  • Analysis of conserved motifs across related transporters to identify critical functional domains

  • Creation of chimeric proteins to identify specificity-determining regions

To quantitatively assess the effects of these mutations, researchers would need to conduct transport assays measuring:

ParameterWild-type gltKMutant gltK variants
Km (substrate affinity)X μMVariable based on mutation
Vmax (maximum transport rate)Y nmol/min/mgVariable based on mutation
Substrate specificity profileGlutamate/aspartatePotentially altered range
Transport efficiency (Vmax/Km)ZVariable based on mutation

The non-radioactive assay methodology described in search result would be particularly valuable for these comparative studies, allowing efficient screening of multiple mutants without the hazards of radioactive materials.

What structural features of gltK determine its interaction with other components of the transport complex?

Understanding the structural features that mediate interactions between gltK and other transport complex components requires high-resolution structural data. While specific structural information for gltK is not provided in the search results, approaches similar to those used for periplasmic glucose-binding protein can be applied :

  • X-ray crystallography of gltK in different conformational states (unliganded, substrate-bound, and in complex with other transporter components)

  • Cryo-electron microscopy of the assembled transport complex

  • Molecular dynamics simulations to predict conformational changes during the transport cycle

Structural studies would focus on identifying:

  • Transmembrane helices involved in substrate translocation

  • Interface regions that interact with ATP-binding components

  • Regions that interact with the periplasmic binding protein

  • Conformational changes triggered by substrate binding and ATP hydrolysis

These structural insights could be complemented by biochemical approaches such as cross-linking studies, mutagenesis of predicted interface regions, and in vitro reconstitution of the transport complex with purified components.

How can one develop a high-yield expression system for recombinant gltK?

Developing a high-yield expression system for recombinant gltK requires addressing the challenges associated with membrane protein expression. Based on approaches used for other difficult-to-express proteins, a comprehensive strategy might include:

  • Vector optimization:

    • Selection of appropriate promoters (T7, tac, or araBAD)

    • Incorporation of fusion tags to aid in expression and purification

    • Codon optimization for E. coli expression

  • Host strain engineering:

    • Creation of modified strains with enhanced capacity for membrane protein expression

    • Integration of supportive genes into the host chromosome, similar to the BL-21(glpK+) strain described in search result

    • Selection of strains with reduced proteolytic activity

  • Culture condition optimization:

    • Implementation of fed-batch cultivation with controlled nutrient feeding

    • Temperature downshift after induction to slow protein synthesis and improve folding

    • Addition of membrane-stabilizing compounds or osmolytes

  • Co-expression strategies:

    • Co-expression with molecular chaperones to assist protein folding

    • Co-expression with substrate utilization genes to alleviate metabolic stress, similar to the glpK co-expression approach

For high-density cultures, exponential feeding of complex substrates containing appropriate carbon sources would be essential to increase biomass and maximize protein yields . The feeding strategy should be tailored to the metabolic capabilities of the engineered host strain.

What purification strategies are most effective for obtaining functional gltK?

Purification of functional gltK requires specialized approaches due to its membrane-embedded nature. An effective purification strategy would include:

  • Membrane isolation and solubilization:

    • Careful cell lysis to isolate membrane fractions

    • Selection of appropriate detergents for solubilization (e.g., n-dodecyl-β-D-maltoside, lauryl maltose neopentyl glycol)

    • Optimization of detergent concentration to maintain protein stability

  • Affinity chromatography:

    • Utilization of engineered affinity tags (His-tag, FLAG-tag)

    • Implementation of metal affinity chromatography (IMAC) for initial capture

    • Gentle washing and elution conditions to preserve protein structure

  • Size exclusion chromatography:

    • Separation of monomeric protein from aggregates

    • Assessment of quaternary structure

    • Buffer exchange into stabilizing formulations

  • Functional verification:

    • Application of non-radioactive transport assays using stable isotope-labeled substrates

    • Assessment of substrate binding using fluorescence-based techniques

    • Verification of ATPase activity of the reconstituted complex

Throughout the purification process, maintaining the native-like lipid environment or incorporating specific lipids during reconstitution can be crucial for preserving gltK function.

How can crystallography techniques be applied to determine gltK structure?

Crystallography of membrane proteins like gltK presents unique challenges compared to soluble proteins. Based on approaches described for other membrane-associated proteins , a comprehensive strategy would include:

  • Protein preparation:

    • Expression and purification of gltK in detergent micelles

    • Screening of different detergents for stability and homogeneity

    • Consideration of lipidic cubic phase (LCP) crystallization

  • Crystallization condition screening:

    • Systematic testing of precipitants, pH conditions, and additives

    • Implementation of high-throughput crystallization platforms

    • Utilization of lipid-detergent mixed micelles or bicelles to mimic membrane environment

  • Data collection and processing:

    • Selection of appropriate cryoprotectants compatible with membrane protein crystals

    • Collection of diffraction data using synchrotron radiation sources

    • Processing of data with specialized software packages

  • Structure determination and refinement:

    • Phase determination using molecular replacement or experimental phasing methods

    • Iterative model building and refinement

    • Validation of the final structure against experimental data

For gltK specifically, crystallizing the protein in different functional states (e.g., substrate-bound, ATP-bound) would provide valuable insights into the transport mechanism. The approach used for periplasmic glucose-binding protein, which involved crystallization in both unliganded and substrate-bound forms , could serve as a model for gltK structural studies.

What methods can be used to study gltK-mediated transport kinetics in real-time?

Real-time analysis of gltK-mediated transport presents methodological challenges that require specialized approaches. Several techniques can be adapted from those used for other transport proteins:

  • Stable isotope-based LC-MS/MS assays:

    • Time-course sampling of isotope-labeled substrate uptake

    • Rapid quenching of transport at defined time points

    • Quantitative analysis of internalized substrate via LC-MS/MS

  • Fluorescence-based approaches:

    • Development of fluorescent substrate analogs

    • Utilization of pH-sensitive fluorescent probes to detect co-transported protons

    • Implementation of stopped-flow spectroscopy for rapid kinetic measurements

  • Genetically encoded biosensors:

    • Design of FRET-based biosensors responding to substrate concentration changes

    • Expression of biosensors in cells expressing recombinant gltK

    • Real-time fluorescence microscopy to visualize transport events

  • Electrophysiological methods:

    • Reconstitution of gltK in planar lipid bilayers

    • Measurement of substrate-induced currents in voltage-clamp configuration

    • Correlation of electrical signals with transport events

A comprehensive kinetic analysis would include determination of:

Kinetic ParameterMeasurement ApproachExpected Information
Initial rateTime-course sampling at early timepointsMaximum transport velocity
Steady-state accumulationPlateau measurements at equilibriumMaximum substrate concentration gradient
Temperature dependenceAssays at varying temperaturesActivation energy of transport
pH dependenceAssays at varying pH valuesInvolvement of proton coupling
Inhibitor effectsCompetition assays with transport inhibitorsBinding site characteristics

How can understanding gltK function contribute to biotechnological applications?

Understanding gltK function has several potential biotechnological applications, particularly in areas requiring enhanced nutrient transport in bacterial systems:

  • Strain engineering for enhanced amino acid production:

    • Optimization of glutamate/aspartate uptake for metabolic engineering

    • Development of feedback-resistant transport systems for improved yields

    • Integration with downstream metabolic pathways for novel product synthesis

  • Design of whole-cell biosensors:

    • Creation of reporter systems linked to gltK activity for environmental monitoring

    • Development of high-throughput screening platforms for drug discovery

    • Engineering of biosensors for detection of glutamate/aspartate in complex samples

  • Protein production enhancement:

    • Application of insights from gltK research to improve expression of other membrane proteins

    • Development of co-expression strategies to alleviate metabolic stress in production hosts

    • Creation of designer E. coli strains with optimized transport capabilities

  • Drug discovery platforms:

    • Utilization of gltK as a model system for studying bacterial transport inhibitors

    • Implementation of non-radioactive transport assays for screening potential antimicrobials

    • Structure-based design of compounds targeting bacterial nutrient acquisition

By combining recombinant protein expression expertise with advanced transport assay methodologies, researchers can leverage gltK research for diverse biotechnological applications.

What computational approaches can predict gltK structure-function relationships?

Computational approaches offer valuable tools for predicting structure-function relationships in transport proteins like gltK:

  • Homology modeling and threading:

    • Utilization of solved structures of related transporters as templates

    • Refinement of models based on evolutionary conservation

    • Validation through comparison with experimental data

  • Molecular dynamics simulations:

    • Simulation of gltK behavior in membrane environments

    • Prediction of conformational changes during the transport cycle

    • Identification of water molecules and ions involved in substrate translocation

  • Docking and virtual screening:

    • Prediction of substrate binding modes

    • Identification of potential inhibitor binding sites

    • Virtual screening of compound libraries for novel modulators

  • Quantum mechanics/molecular mechanics (QM/MM) calculations:

    • Detailed analysis of substrate-protein interactions

    • Investigation of transition states during transport

    • Prediction of energetics for different transport steps

These computational approaches can generate testable hypotheses about critical residues involved in substrate recognition, conformational changes, and interaction with other components of the transport system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.