Recombinant Escherichia coli Glycerol uptake facilitator protein (glpF)

Shipped with Ice Packs
In Stock

Description

Discovery and Classification

The glycerol facilitator protein of Escherichia coli is encoded by the glpF gene and stands as a historically significant example of a transport protein that catalyzes facilitated diffusion across the E. coli inner membrane. Early research established that glycerol uptake in E. coli occurs through a specific protein-mediated process rather than simple diffusion alone . This discovery was pivotal in establishing the concept of facilitated diffusion in prokaryotic systems. GlpF belongs to the major intrinsic protein (MIP) family and serves as an archetypal member of the aquaporin superfamily, which includes channels selective for water or other small neutral molecules .

Physiological Significance

Within the bacterial cell, GlpF plays a crucial role in glycerol metabolism by mediating the entry of glycerol into the cytoplasm. Once inside the cell, glycerol is phosphorylated by glycerol kinase (encoded by glpK) to produce glycerol-3-phosphate, which becomes trapped within the cell due to its charged nature. This phosphorylation step is essential for glycerol utilization as a carbon and energy source . The expression of glpF is regulated as part of the glp regulon, being induced by glycerol or sn-glycerol-3-phosphate and repressed by glucose, demonstrating its integration into the broader metabolic network of E. coli .

Chromosomal Location and Operon Structure

The glpF gene is located at the 88-minute position on the Escherichia coli chromosome and is transcribed counterclockwise . Molecular analysis has revealed that glpF exists as the first gene in an operon with glpK (encoding glycerol kinase) and glpX, forming the glpFKX operon . This genetic organization reflects the functional relationship between glycerol transport and its subsequent metabolism, as the co-transcription of transport and kinase genes enables coordinated expression of these functionally related proteins .

Regulatory Elements

Transcription of the glpFKX operon is subject to complex regulation involving both activation and repression mechanisms. The operon is negatively regulated by the GlpR repressor protein, resulting in constitutive expression in glpR mutant strains . Additionally, the expression is inducible by both glycerol and sn-glycerol-3-phosphate, the latter being a metabolic intermediate in glycerol metabolism . This regulation ensures that the glycerol transport system is expressed when substrate is available and repressed under conditions where glycerol utilization is not advantageous, such as during growth with preferred carbon sources like glucose .

Comparative Genomics

Sequence analysis comparing the glpFKX region between Escherichia coli and Shigella flexneri has revealed interesting evolutionary insights. The two sequences show remarkable conservation with only 1.1% difference across 2,167 base pairs, excluding repetitive sequence regions . A notable difference in S. flexneri is an amber mutation in place of the tryptophan 215 codon in glpF, which has implications for protein function. Another significant difference is the presence of two repetitive (REP) sequences directly behind glpK in S. flexneri that are absent in E. coli, although these differences do not appear to affect glycerol transport or growth on glycerol .

Quaternary Structure

Electron microscopy studies of recombinant GlpF have revealed that the protein assembles into a tetrameric structure with approximately 80 Å side length . This tetrameric organization was confirmed by scanning transmission electron microscopy, which yielded a molecular mass of 170 kDa for the complete assembly . The tetrameric arrangement is a common feature shared with other members of the aquaporin family, suggesting evolutionary conservation of this quaternary structure for functional channels.

Expression Systems and Strategies

Recombinant production of GlpF has been achieved using E. coli expression systems. The glpF gene has been cloned into various plasmid vectors for both complementation studies and protein production . One successful approach involved the addition of a histidine tag to facilitate purification of the recombinant protein . Early cloning efforts encountered challenges related to plasmid copy number, with successful transport-positive clones only obtained after introducing a pcnB mutation into the host strain to reduce plasmid copy number . This suggests that high-level expression of GlpF may be detrimental to cell physiology, possibly due to membrane disruption.

Purification Techniques

Purification of recombinant GlpF to homogeneity has been achieved using a combination of techniques suitable for membrane proteins. After overexpression, the protein was solubilized using octylglucoside, a non-ionic detergent effective for extracting membrane proteins . The histidine-tagged protein could then be purified using affinity chromatography, allowing for the isolation of highly pure protein suitable for structural studies. The ability to produce and purify sufficient quantities of GlpF represented a significant breakthrough that enabled subsequent structural investigations.

Reconstitution and Crystallization

For structural studies, purified GlpF has been successfully reconstituted in the presence of lipids to form two-dimensional crystals . These crystals were highly ordered and diffracted electrons to a resolution of 3.6 Å, allowing for detailed structural analysis by electron crystallography . The successful reconstitution of GlpF in lipid bilayers not only facilitated structural studies but also provided a system for functional characterization of the transport properties in a controlled environment.

Transport Properties

GlpF mediates the facilitated diffusion of glycerol across the E. coli inner membrane, allowing glycerol to move down its concentration gradient without the expenditure of cellular energy . This transport mechanism differs fundamentally from active transport systems that require energy input. The transport activity of GlpF is specific for glycerol and a limited number of related small molecules. The rate of glycerol uptake in cells expressing recombinant GlpF increases with plasmid copy number, demonstrating a direct relationship between the amount of GlpF protein and transport capacity .

Substrate Selectivity

As a member of the aquaporin family, GlpF exhibits selective permeability that allows it to discriminate between different substrates. While it efficiently transports glycerol, it shows limited permeability to water compared to dedicated water channels like AQP1. This selectivity is achieved through the specific dimensions and chemical properties of the channel formed by the protein. The larger density minimum observed in the structural studies of GlpF compared to AQP1 correlates with its preference for the larger glycerol molecule .

Coupling with Metabolism

The transport function of GlpF is tightly coupled to glycerol metabolism through the sequential action of glycerol kinase (GlpK). After glycerol enters the cytoplasm via GlpF, it is rapidly phosphorylated by glycerol kinase to produce glycerol-3-phosphate . This phosphorylation effectively traps the glycerol inside the cell since the charged phosphate group prevents the molecule from diffusing back through the membrane. This "trap-door" mechanism allows the cell to accumulate glycerol despite the bidirectional nature of facilitated diffusion, demonstrating an elegant solution to the challenge of nutrient acquisition .

Unique Features Among E. coli Transporters

Within the context of E. coli transport systems, GlpF stands out as a rare example of a facilitator protein. Most nutrient transport in E. coli occurs through active transport mechanisms, such as ATP-binding cassette (ABC) transporters or ion-coupled symporters, which can accumulate substrates against a concentration gradient. In contrast, GlpF represents a simpler transport mechanism that relies on diffusion along a concentration gradient. It was noted that propanediol facilitator may be another example of facilitated diffusion in E. coli, but glycerol transport via GlpF remains the best-characterized example .

Evolutionary Conservation

The high degree of sequence conservation observed between the glpF genes of E. coli and S. flexneri (98.9% identity) suggests strong evolutionary pressure to maintain the structure and function of the glycerol facilitator protein . This conservation extends to other bacteria that utilize glycerol as a carbon source, reflecting the importance of this transport system in bacterial metabolism. The similarities between bacterial GlpF and mammalian aquaporins also point to ancient evolutionary origins for this protein family, with specialized functions emerging through divergent evolution.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please clearly indicate your desired format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please let us know and we will prioritize its development.
Synonyms
glpF; b3927; JW3898; Glycerol uptake facilitator protein; Aquaglyceroporin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
glpF
Target Protein Sequence
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAGVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHIVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPLLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPIVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
Uniprot No.

Target Background

Function
This protein serves as a transporter of glycerol across the cytoplasmic membrane, exhibiting limited permeability to water and small uncharged compounds like polyols.
Gene References Into Functions
  1. Mutation of tryptophan Trp219 affects the aqualgyeroporin GlpF activity and the stability of the active GlpF tetramer. PMID: 29069569
  2. Osmotic water permeabilities of aquaporins AQP4, AQP5, and GlpF from near-equilibrium simulations have been presented. PMID: 28455098
  3. The folding process of aquaglyceroporin GlpF plays a crucial role in determining its stability. (Review) PMID: 25462169
  4. TMAO enhances the heat stability of the GF tetramer by an average of 10 degrees C in the presence of 4 detergents, and also protects the protein from denaturation by SDS. PMID: 25387032
  5. The tetrameric alpha-helical GlpF unfolds via a dimeric folding intermediate. PMID: 22035256
  6. GlpF exhibits high permeability to small solutes and permeability to larger solutes. PMID: 18202181
  7. GlpF exists as a stably folded tetramer in detergent solutions of neutral dodecyl maltoside and in zwitterionic lysomyristoylphosphatidylcholine. PMID: 18284214

Show More

Hide All

Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is the glpF gene organized in the E. coli genome?

The glpF gene exists as the promoter-proximal gene in an operon with glpK (encoding glycerol kinase) at the 88 minute position of the E. coli chromosome . This operon is transcribed counterclockwise on the chromosome, with glpF positioned upstream of glpK . This genetic organization has functional significance, as insertional mutations in glpF have been shown to be polar on glpK expression, while insertions in the distal glpK gene do not affect expression of glpF .

The operon structure allows coordinated expression of both the transport (GlpF) and metabolic (glycerol kinase) functions, which is logically beneficial since glycerol must be both transported into the cell and phosphorylated to be utilized effectively. The genes of the glp regulon, including the glpFK operon, are under common negative control exerted by the product of the glpR gene, allowing coordinated regulation of glycerol uptake and metabolism .

What are the key structural features of the GlpF channel?

The GlpF protein forms a tetrameric structure in the membrane, with each monomer functioning as an independent channel. Electron crystallography studies have revealed that the GlpF monomer comprises six highly tilted rod-like structures (transmembrane helices) that surround a central channel . When compared to the water channel aquaporin-1 (AQP1), GlpF exhibits distinct additional domains (labeled D1-D5 in structural studies) that likely relate to the specific function of transporting glycerol rather than water molecules .

The channel formed by GlpF has several distinctive characteristics: it appears slightly larger than that of AQP1, with a minimal pore diameter of 3.3 Å compared to 2.8 Å for AQP1 . Additionally, the GlpF channel is more uniform in size throughout its length and lacks the pronounced bend observed in the AQP1 channel . This structural difference is partly attributed to amino acid variations in the channel constriction region, where a phenylalanine (F24) in AQP1 is replaced by a leucine in GlpF, potentially accounting for the different substrate specificities of these related proteins .

How does the quaternary structure of GlpF compare to other members of the aquaporin family?

How is GlpF expression regulated in response to environmental conditions?

The expression of GlpF is subject to both positive and negative regulatory mechanisms that respond to environmental conditions and available carbon sources. Studies have demonstrated that glycerol transport activity is induced by glycerol or sn-glycerol-3-phosphate (G3P), repressed by growth in the presence of glucose (catabolite repression), and constitutively expressed in strains carrying mutations in the glp regulon repressor (glpR) .

When testing the inducibility of plasmid-encoded glycerol transport, researchers observed that transport activity was lower in cells grown on glucose (approximately 235 pmol/min per 10^9 cells) compared to cells grown on maltose (about 420 pmol/min per 10^9 cells), which exerts no catabolite repression . Growth on G3P, an inducer of the glp regulon, did not significantly increase transport activity beyond the rate observed with maltose growth . These observations highlight the complex regulation of GlpF expression, involving both substrate induction and catabolite repression mechanisms that allow E. coli to optimize energy utilization by preferentially using glucose when available.

What is the relationship between GlpF expression and glycerol metabolism?

The functional relationship between GlpF-mediated glycerol transport and subsequent metabolism is critical for understanding the physiological role of this protein. Once glycerol enters the cytoplasm via GlpF, it must be rapidly phosphorylated by glycerol kinase (encoded by glpK) to form sn-glycerol-3-phosphate (G3P) . This phosphorylation step is essential because it effectively traps glycerol inside the cell by preventing its diffusion back out through the GlpF channel .

The coordinated expression of glpF and glpK in the same operon ensures that cells expressing the glycerol facilitator also express the kinase needed to metabolize the transported glycerol. This genetic organization reflects the biological necessity of coordinating transport with metabolism. Experimental evidence for this coordination comes from studies of insertion mutants, where insertions in glpF were found to be polar on glpK, resulting in strains defective in both transport and phosphorylation functions .

What methods are commonly used to clone and express recombinant GlpF protein?

Researchers have successfully cloned and expressed recombinant GlpF using several approaches, as documented in the literature. The glpF gene has been cloned by identifying and isolating the genomic region containing the glpFK operon . Complementation analysis, where the cloned gene restores function in glycerol transport-deficient mutants, provides confirmation of successful cloning .

For expression studies, recombinant GlpF has been produced with affinity tags, such as histidine tags, to facilitate purification. In published protocols, GlpF has been overexpressed, solubilized in detergents like octylglucoside, and purified to homogeneity . The expression system typically involves controlled induction, followed by membrane fraction isolation, detergent solubilization, and affinity chromatography steps.

The following table summarizes key expression parameters used in successful GlpF production:

ParameterTypical ConditionsNotes
Expression HostE. coli strains (e.g., GD173, MC4100)Host selection depends on experimental goals
InductionIPTG for T7 promoter systemsExpression levels vary with plasmid copy number
SolubilizationOctylglucosideCritical for maintaining protein structure
PurificationNi-NTA affinity chromatography for His-tagged proteinYields highly purified protein
Yield200-300 pmol/min per 10^9 cells (transport activity)Higher than chromosomal expression levels

How can the structure of GlpF be studied using electron crystallography?

Electron crystallography has been a valuable technique for elucidating the structure of GlpF at medium to high resolution. The process involves several key steps, beginning with the production of two-dimensional crystals of purified protein. For GlpF studies, researchers have used electron microscopes such as the Jeol 3000 SFF in spot scan mode to collect image data from both untilted and tilted lattices .

After data collection, image processing follows a rigorous protocol that includes:

  • Lattice unbending to correct for crystal distortions

  • Contrast transfer function (CTF) correction

  • Phase origin refinement

  • Fitting of lattice lines for amplitudes and phases normal to the membrane plane

  • Calculation of a three-dimensional map using specialized crystallographic software

This approach has yielded structural information for GlpF at a resolution of 6.9 Å, revealing the arrangement of transmembrane helices and the channel architecture . The resulting electron density maps enabled comparison with the atomic structure of the related protein AQP1 and facilitated homology modeling of GlpF . The quality of the structural data is assessed using phase residuals, R-factors, and Fourier shell correlation coefficients, with the reported structure of GlpF showing a completeness of 68.0% within the resolution volume .

How does the mechanism of glycerol transport through GlpF differ from other transport mechanisms in E. coli?

The glycerol facilitator (GlpF) represents a distinct transport mechanism in E. coli, operating via facilitated diffusion rather than active transport . Unlike transporters that couple substrate movement to energy expenditure (ATP hydrolysis or ion gradients), GlpF provides a selective channel that increases the rate of glycerol diffusion down its concentration gradient without energy input .

The unique characteristics of GlpF-mediated transport include:

  • Bidirectional movement based solely on concentration gradients

  • No accumulation of substrate against a concentration gradient

  • No direct coupling to energy expenditure

  • Reliance on metabolic trapping (phosphorylation by glycerol kinase) to maintain an inward concentration gradient

This mechanism contrasts with ABC transporters, proton symporters, and other active transport systems abundant in E. coli. The specificity of GlpF for glycerol (and potentially other small polyols like propanediol) is determined by the structure of its channel, particularly the pore size (3.3 Å minimum diameter) and specific amino acid composition that facilitates interaction with glycerol while excluding other molecules .

How can homology modeling be used to predict GlpF structure based on aquaporin structures?

Homology modeling has proven valuable for understanding GlpF structure, particularly through comparison with the better-characterized aquaporin family member AQP1. Researchers have used the atomic structure of AQP1 together with sequence alignments between AQP1 and GlpF to build structural models using specialized software like WHATIF .

The process involves several critical steps:

  • Sequence alignment of GlpF with the template structure (AQP1)

  • Construction of a backbone model based on conserved regions

  • Side-chain modeling, including manual refinement of key residues like W42 and Y138 using rotamer databases to select conformations that don't block the channel

  • Validation of the model by comparing calculated projections with experimental projection maps

  • Analysis of channel properties using specialized software like HOLE, which probes accessible channel surfaces

The validation of homology models against experimental data is crucial. For GlpF, researchers confirmed their model by comparing calculated projections with experimental 2D projection maps, finding that the wider pore region observed experimentally was also present in the calculated projections derived from the model . This congruence suggested that the structural model was correct within experimental error limitations.

What experimental approaches can resolve contradictory data about GlpF structure-function relationships?

When faced with contradictory data regarding GlpF structure-function relationships, researchers can employ several complementary approaches to resolve discrepancies:

  • Multi-technique structural analysis: Combining electron crystallography with X-ray crystallography and emerging cryo-EM methodologies can provide structural information at different resolutions and under different conditions, helping to identify artifacts or condition-dependent structural features .

  • Functional validation through mutagenesis: Systematic site-directed mutagenesis of residues implicated in channel function, followed by transport assays, can connect structural features to functional outcomes. For example, replacing key residues in GlpF with corresponding residues from AQP1 (such as substituting Leu for Phe at positions equivalent to F24 in AQP1) can test hypotheses about substrate selectivity determinants .

  • In silico molecular dynamics simulations: Computational approaches using the structural models as starting points can simulate glycerol movement through the channel under various conditions, providing insights that may explain seemingly contradictory experimental results.

  • Varied expression systems and purification methods: Some contradictions may arise from the effects of expression systems or purification methods on protein structure or function. Comparing GlpF expressed and purified under different conditions can identify method-dependent artifacts .

What are the unresolved questions about GlpF that require further investigation?

Despite significant progress in understanding GlpF, several important questions remain unresolved and merit further investigation:

  • Detailed transport kinetics: While GlpF is known to facilitate glycerol diffusion, the precise kinetics of transport, including potential regulatory mechanisms that might modulate transport rates post-translationally, remain to be fully characterized.

  • Substrate range beyond glycerol: Initial research suggested that propanediol might also be transported by GlpF or a similar facilitator , but the full range of physiologically relevant substrates and their relative transport efficiencies require systematic investigation.

  • Interactions with glycerol kinase: The functional coupling between transport via GlpF and phosphorylation by glycerol kinase suggests possible protein-protein interactions, but the structural basis for any such interactions remains unexplored.

  • High-resolution structure determination: While electron crystallography has provided valuable structural insights at 6.9 Å resolution , atomic-resolution structures from X-ray crystallography or advanced cryo-EM would provide crucial details about substrate binding sites and channel gating mechanisms.

  • Evolutionary relationships within the aquaporin superfamily: More comprehensive comparative analysis of GlpF with other aquaporins and glycerol facilitators across species could illuminate the evolutionary history of substrate specificity within this ancient protein family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.