Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
hlyE; clyA; hpr; sheA; ycgD; b1182; JW5181; Hemolysin E, chromosomal; Cytotoxin ClyA; Hemolysis-inducing protein; Latent pore-forming 34 kDa hemolysin; Silent hemolysin SheA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-303
Protein Length
Full Length of Mature Protein
Species
Escherichia coli (strain K12)
Target Names
hlyE
Target Protein Sequence
TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVL VGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLD DGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGA AAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQNFFTTLSNTVKQANKDIDAAKL KLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAAKKMINTCNEYQKRHGKKTLFEVP EV
Uniprot No.

Target Background

Function

This toxin exhibits hemolytic activity against mammalian cells by forming pore-like structures upon cellular contact.

Gene References Into Functions
References:
  1. Membrane-triggered conformational transition of ClyA: PMID: 27797514
  2. Assembly dynamics of the cytolytic pore toxin ClyA: PMID: 25652783
  3. Elevated clyA+ locus expression in uropathogenic E. coli, partly due to SfaX/PapX regulators: PMID: 25178918
  4. ClyA's oligomeric conformation within outer membrane vesicles (OMVs) and prepore formation: PMID: 24019520
  5. HlyB's role in enhancing cyclodextrin glucanotransferase secretion in E. coli: PMID: 20959127
  6. Possible incompatibility between HlyA and SheA in extraintestinal E. coli infections: PMID: 15956433
  7. Analysis of the HlyE (ClyA, SheA) channel in its membrane-bound form: PMID: 16754675
  8. hlyE expression control by SlyA and H-NS nucleoprotein complexes in E. coli: PMID: 17892462
  9. HlyE protomer structure in oligomerized pore formation: PMID: 18227266
  10. Lack of correlation between clyA and irp2 genes and SIDS in infant intestinal E. coli: PMID: 19208875
Database Links

KEGG: ecj:JW5181

Protein Families
Hemolysin E family
Subcellular Location
Secreted. Periplasm. Host cell membrane; Single-pass membrane protein. Note=Exported from the cell by outer membrane vesicles. Also found in the periplasmic space.

Q&A

What is Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE)?

Recombinant Escherichia coli Hemolysin E, chromosomal (hlyE) is a purified recombinant protein with a molecular weight of approximately 21.2 kDa . It belongs to a family of pore-forming toxins found in several enterobacterial species including Escherichia coli, Salmonella typhi, and Shigella flexneri . This protein is also known by several alternative names including Cytotoxin ClyA, Hemolysis-inducing protein, Latent pore-forming 34 kDa hemolysin, and Silent hemolysin SheA . As a recombinant protein, it is typically produced with high purity (>90%) for research applications and maintains its native structural and functional properties, including its ability to form transmembrane pores in target cells. The protein's hemolytic activity is integral to its role in bacterial pathogenesis, making it an important subject for research in infectious disease mechanisms and potential therapeutic targets.

How does Hemolysin E function as a pore-forming toxin?

Hemolysin E functions through a sophisticated mechanism involving structural transformation and membrane integration. The toxin initially exists as water-soluble monomers that undergo conformational changes upon encountering target cell membranes . This transformation facilitates oligomerization of multiple hlyE units, which collectively form transmembrane pores in the lipid bilayer of host cells. Electron microscopy studies have visualized this process, revealing how hlyE units assemble in the presence of lipids to create functional pores .

The pore formation process follows several discrete steps:

  • Initial binding to the target membrane

  • Conformational change exposing hydrophobic regions

  • Oligomerization of multiple hlyE monomers

  • Insertion into the lipid bilayer

  • Formation of a functional transmembrane pore

This pore-forming ability disrupts membrane integrity, leading to cellular content leakage, ion imbalance, and ultimately cell lysis in erythrocytes or cytotoxicity in nucleated cells. The protein's hemolytic activity, from which it derives its name, reflects this membrane-disrupting capacity. Understanding this mechanism has significant implications for studying bacterial virulence strategies and potential approaches for neutralizing toxin-mediated damage during infection. The elucidation of both the soluble and membrane-integrated forms provides complementary insights into hlyE's functional transitions during the pore formation process .

What experimental approaches reveal the oligomerization mechanism of Hemolysin E?

The oligomerization process of Hemolysin E represents a critical aspect of its pore-forming capability and requires sophisticated experimental approaches to elucidate. Researchers have employed a combination of structural biology techniques to characterize this process. X-ray crystallography at 2.0 Å resolution has provided detailed atomic-level information about the water-soluble monomeric form, while electron microscopy has been instrumental in visualizing the lipid-associated oligomeric assemblies .

To study the oligomerization mechanism effectively, researchers utilize:

TechniqueApplication to hlyE ResearchResolution/Information Obtained
X-ray CrystallographySoluble monomer structure2.0 Å atomic resolution
Electron MicroscopyLipid-associated oligomersLow-resolution projection images
Fluorescence SpectroscopyConformational changesReal-time transition dynamics
Liposome Leakage AssaysFunctional pore formationKinetics of pore assembly
Cross-linking StudiesOligomer architectureSubunit arrangement

These complementary approaches have revealed that hlyE monomers undergo significant conformational rearrangements upon membrane contact, exposing previously buried hydrophobic surfaces that facilitate oligomer formation. The resulting transmembrane pores exhibit a defined stoichiometry and architecture optimized for membrane perforation. Current research focuses on identifying specific amino acid residues involved in oligomer interfaces and how variations in lipid composition affect the efficiency of pore assembly. Understanding this mechanism provides insights into potential strategies for inhibiting toxin action during bacterial infections .

How can contradictions in Hemolysin E research data be systematically analyzed?

Clinical and molecular research on Hemolysin E occasionally produces contradictory findings, necessitating systematic approaches to reconcile these differences. The field of clinical contradiction detection offers valuable methodologies that can be applied to hlyE research. When analyzing contradictory hlyE data, researchers should implement a structured approach that considers experimental context, methodological differences, and domain-specific knowledge .

A systematic framework for analyzing contradictions in hlyE research includes:

  • Ontology-driven classification of contradictory statements about hlyE properties or functions

  • Distinction between apparent contradictions (terminological differences) and genuine contradictions (conflicting experimental outcomes)

  • Consideration of experimental conditions, including bacterial strains, recombinant production methods, and assay systems

  • Evaluation of contradictions within the context of specific domains (structural biology vs. immunology)

Machine learning approaches can assist in identifying patterns within contradictory literature. Recent advances in contradiction detection using distant supervision and ontology-based methods have proven effective in medical literature analysis . These approaches can be adapted for hlyE research by training models on paired sentences from the extensive PubMed database containing potentially contradictory hlyE findings.

For instance, statements about hemolytic activity under different pH conditions may appear contradictory until analyzed within their experimental context. Similarly, apparent discrepancies in molecular weight reports (34 kDa vs. 21.2 kDa) may be reconciled by distinguishing between the full-length native protein and recombinant partial constructs . This systematic approach helps researchers build a coherent understanding of hlyE biology despite seemingly conflicting literature.

What are the key considerations for structural-functional correlations in Hemolysin E research?

Establishing correlations between the structure and function of Hemolysin E requires careful experimental design and integrated analytical approaches. The unique helical bundle architecture of hlyE (approximately 100 Å long) directly relates to its pore-forming capabilities . When investigating structure-function relationships, researchers should consider several critical factors:

  • Domain-specific mutagenesis studies to identify functional regions:

    • Membrane-interacting domains

    • Oligomerization interfaces

    • Pore-lining residues

  • Conformational transitions between soluble and membrane-bound states:

    • Triggers for conformational change

    • Intermediate structural states

    • Energy requirements for transitions

  • Species-specific variations affecting function:

    • Comparing E. coli, Salmonella typhi, and Shigella flexneri variants

    • Evolutionary conservation of functional motifs

    • Host-specific adaptations

The integration of structural data from X-ray crystallography with functional assays provides the most comprehensive insights. For example, the crystal structure has enabled the development of a model for pore formation that explains the functional properties observed in membrane leakage assays . This model suggests specific regions of the protein undergo significant rearrangement during membrane interaction, exposing hydrophobic surfaces essential for oligomerization.

Researchers should also consider how post-translational modifications or experimental conditions might affect structure-function correlations. The high purity (>90%) of recombinant preparations is essential for reliable structural studies, while ensuring proper folding is critical for functional analyses . By systematically exploring these structure-function relationships, researchers can identify potential sites for targeted modifications or inhibitory strategies.

What are the optimal conditions for storage and handling of recombinant Hemolysin E?

Maintaining the structural and functional integrity of recombinant Hemolysin E requires strict adherence to specific storage and handling protocols. The protein should be stored at -20°C, with careful attention to avoiding freeze/thaw cycles that can compromise its structure and activity . When designing experiments involving hlyE, researchers should consider the following recommendations:

ParameterOptimal ConditionRationaleMonitoring Method
Storage Temperature-20°CPrevents degradationActivity assays after storage
Buffer CompositionTris/PBS-basedMaintains pH stabilitypH monitoring
Freeze/Thaw CyclesMinimize (aliquot upon receipt)Prevents protein denaturationSDS-PAGE integrity check
Working Temperature4°C when thawedReduces degradation rateActivity retention testing
Concentration RangeExperiment-dependent (nanograms sufficient for immunoassays)Optimize for specific applicationBradford/BCA assay

For immunoassay applications, nanogram quantities of hlyE have been shown to be sufficient for detecting IgG and IgA isotypes in patient sera . When working with the protein, maintain aseptic conditions to prevent microbial contamination, which can introduce proteases that degrade the sample. Prior to experimental use, verify protein integrity using SDS-PAGE analysis to confirm the expected molecular weight of 21.2 kDa .

For long-term research projects, consider evaluating protein stability over time by periodically testing aliquots for activity retention. Creating a stability profile specific to your laboratory conditions can help establish reliable experimental timelines. Additionally, when shipping the protein between facilities, ensure continuous cold chain maintenance to preserve its structural and functional properties.

How can Hemolysin E be effectively used in immunoassay development?

Hemolysin E has demonstrated significant potential in immunodiagnostic applications, particularly for typhoid and paratyphoid fever detection. Research has shown that nanogram amounts of hlyE are sufficient for detecting both IgG and IgA isotype antibody responses in patient sera . When developing immunoassays based on hlyE, researchers should follow these methodological guidelines:

The high specificity (100%) of hlyE-based immunoassays makes them particularly valuable for distinguishing between typhoid and non-typhoid cases, addressing a significant challenge in regions where typhoid fever is endemic alongside other febrile illnesses . When developing new assay formats, researchers should include appropriate controls, including known positive and negative sera, to ensure assay performance is consistent with established parameters.

For advanced applications, consider multiplexing hlyE with other Salmonella antigens to improve sensitivity while maintaining the high specificity offered by hlyE alone. This approach may be particularly valuable in epidemiological studies or in settings where typhoid and paratyphoid co-circulation occurs.

What analytical techniques are most effective for studying Hemolysin E structure-function relationships?

Investigating the complex structure-function relationships of Hemolysin E requires an integrated approach utilizing multiple complementary analytical techniques. The unique helical bundle structure and pore-forming capabilities of hlyE necessitate specialized methods to capture both static structures and dynamic transitions .

Analytical TechniqueApplication to hlyE ResearchKey Information Obtained
X-ray CrystallographyHigh-resolution structure of soluble monomersAtomic details at 2.0 Å resolution revealing the elongated helical bundle
Electron MicroscopyVisualization of membrane-associated oligomersLow-resolution projections of pore complexes in lipid environments
Circular Dichroism SpectroscopySecondary structure analysisα-helical content quantification and folding state assessment
Fluorescence SpectroscopyConformational changes during pore formationReal-time monitoring of structural transitions
Surface Plasmon ResonanceMembrane binding kineticsAssociation/dissociation rates with lipid surfaces
Atomic Force MicroscopyTopography of membrane-inserted poresHeight profiles and distribution patterns of assembled pores
Molecular Dynamics SimulationsModeling structural transitionsPrediction of conformational changes and energetic profiles

For functional correlation, these structural techniques should be paired with:

  • Hemolytic activity assays using erythrocytes to measure pore formation efficiency

  • Liposome permeabilization assays to quantify pore size and leakage kinetics

  • Electrophysiology studies to characterize individual pore conductance properties

  • Cell viability assays to assess cytotoxic effects on nucleated cells

The integration of high-resolution crystal structure data with electron microscopy observations has been particularly valuable, enabling the development of molecular models that explain the transition from soluble monomers to membrane-integrated pores . When designing structure-function studies, researchers should carefully consider how experimental conditions might affect protein conformation and activity, ensuring that findings accurately reflect the native properties of hlyE.

How should contradictory findings about Hemolysin E function be reconciled in research?

Contradictory findings regarding Hemolysin E function present a significant challenge in bacterial pathogenesis research. Applying principles from clinical contradiction detection can help researchers systematically address these discrepancies . When confronted with contradictory hlyE functional data, researchers should implement the following reconciliation framework:

  • Contextual Analysis:

    • Examine the experimental systems (in vitro vs. in vivo)

    • Consider bacterial strain variations (laboratory vs. clinical isolates)

    • Evaluate host cell types used in functional studies

    • Assess recombinant protein preparation methods

  • Methodological Differentiation:

    • Compare detection methods (hemolysis assays, cytotoxicity measurements)

    • Analyze quantification approaches and normalization procedures

    • Evaluate statistical methods applied to functional data

    • Consider sensitivity and specificity of different functional assays

  • Domain Knowledge Integration:

    • Apply ontology-based classification of seemingly contradictory statements

    • Utilize distant supervision approaches to identify potential resolvable contradictions

    • Implement machine learning models trained on medical literature to detect genuine contradictions

Recent advances in contradiction detection using natural language processing can assist in analyzing the extensive hlyE literature. Studies show that fine-tuning deep learning models on ontology-driven datasets significantly improves contradiction detection in medical literature . This approach can be adapted specifically for hlyE research by creating specialized datasets focused on bacterial toxin literature.

For example, apparent contradictions in hemolytic activity might be resolved by recognizing differences in experimental pH, temperature, or calcium concentration. Similarly, contradictory findings about host cell specificity might be reconciled by acknowledging variations in cell membrane composition or receptor expression. By systematically applying this reconciliation framework, researchers can build a more coherent understanding of hlyE function despite seemingly conflicting literature.

What statistical approaches are recommended for analyzing Hemolysin E immunoassay data?

The analysis of Hemolysin E immunoassay data requires robust statistical approaches to ensure reliable interpretation, particularly when evaluating diagnostic applications. Based on existing research with hlyE-based immunoassays for typhoid fever, the following statistical methodologies are recommended:

For epidemiological applications, further statistical considerations include:

  • Stratified analysis based on patient demographics or clinical presentation

  • Correlation analysis between antibody levels and disease severity

  • Longitudinal analysis of antibody kinetics over the course of infection

  • Cross-reactivity assessment across related bacterial species

Advanced statistical methods such as Bayesian approaches may be valuable when integrating hlyE immunoassay results with other diagnostic modalities or when testing in populations with varying disease prevalence.

How can variations in experimental results across different Hemolysin E studies be explained?

Variations in experimental results across Hemolysin E studies can stem from multiple sources that must be systematically evaluated to determine whether they represent genuine biological phenomena or methodological differences. Understanding these sources of variation is essential for proper data interpretation and experimental design.

Several factors contribute to inter-study variations in hlyE research:

  • Recombinant Protein Variables:

    • Full-length versus partial recombinant constructs (21.2 kDa partial vs. 34 kDa full-length)

    • Expression systems (E. coli, yeast, cell-free)

    • Purification methods affecting protein folding and activity

    • Storage conditions and protein stability over time

  • Experimental Condition Differences:

    • Buffer composition and pH

    • Temperature and incubation times

    • Presence of cofactors or inhibitors

    • Cell or membrane types used for functional studies

  • Species-Specific Variations:

    • Sequence variations between E. coli, Salmonella typhi, and Shigella flexneri hlyE

    • Strain-specific mutations affecting function

    • Expression regulation differences in different bacterial backgrounds

  • Measurement and Analysis Variables:

    • Detection method sensitivity and dynamic range

    • Data normalization approaches

    • Statistical methods and significance thresholds

    • Reporting conventions and units

To address these variations systematically, researchers should:

  • Clearly document all experimental conditions and protein preparations

  • Include appropriate positive and negative controls

  • Perform direct side-by-side comparisons when possible

  • Consider interlaboratory validation studies for critical findings

The application of ontology-driven approaches for structuring experimental metadata can help identify sources of variation across studies . By categorizing experimental conditions and outcomes using standardized terminology, patterns of variation can be more readily identified and explained. This structured approach to data analysis enables researchers to distinguish between technical variations and genuine biological differences in hlyE behavior across experimental systems.

What are the future research directions for Hemolysin E studies?

Hemolysin E research stands at an exciting intersection of structural biology, immunodiagnostics, and bacterial pathogenesis. Future research directions should build upon the established structural and functional knowledge while addressing remaining questions and applications. Several promising avenues for hlyE research include:

  • Advanced Structural Studies:

    • Cryo-electron microscopy of membrane-inserted pore complexes at near-atomic resolution

    • Time-resolved structural analysis of the conformational transitions during pore formation

    • Comprehensive mapping of species-specific structural variations and their functional implications

  • Expanded Diagnostic Applications:

    • Development of point-of-care diagnostics utilizing hlyE for typhoid detection in resource-limited settings

    • Multiplex platforms combining hlyE with other Salmonella antigens for improved sensitivity

    • Longitudinal studies of anti-hlyE antibody responses during and after infection

  • Therapeutic Targeting Approaches:

    • Structure-based design of small molecule inhibitors targeting critical hlyE functional domains

    • Monoclonal antibody development for neutralizing hlyE during active infection

    • Attenuated toxoid development for potential vaccine applications

  • Advanced Contradiction Resolution Methods:

    • Application of machine learning and natural language processing to systematically analyze the hlyE literature

    • Development of standardized reporting frameworks for hlyE experimental studies

    • Creation of comprehensive databases integrating structural, functional, and immunological data

  • Evolutionary and Ecological Perspectives:

    • Comparative genomics across bacterial species to understand hlyE evolution

    • Investigation of environmental factors regulating hlyE expression in different niches

    • Analysis of host-pathogen coevolution in the context of hlyE recognition by immune systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.