Recombinant Escherichia coli Histidine transport system permease protein hisQ (hisQ)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant HisQ is a permease subunit of the E. coli histidine ABC transporter, responsible for importing histidine across the cytoplasmic membrane. Key features include:

PropertyDetail
Gene NamehisQ (locus tags: b2308, JW2305)
Protein Length228 amino acids (full-length)
TagN-terminal hexahistidine (His6) tag
Molecular Weight (Theoretical)~25.8 kDa (calculated based on sequence)
Expression SystemE. coli
UniProt IDP52094

This protein is part of the hisJQP operon, which includes a periplasmic binding protein (HisJ) and two permease subunits (HisQ and HisM) .

Role in Histidine Transport

HisQ functions as a transmembrane permease that couples ATP hydrolysis (via the ATP-binding protein HisP) to histidine translocation. It operates within a multicomponent ABC transporter system:

  • Forms a heterodimeric channel with HisM .

  • Binds histidine indirectly via interactions with HisJ, the substrate-binding protein .

  • Critical for survival in histidine-limited environments .

His-Tag Utility

The recombinant protein includes a His6 tag for purification via immobilized metal affinity chromatography (IMAC):

His-Tag FeatureSpecification
SequenceHHHHHH (6 residues)
Binding Affinity (Ni²⁺)KD ≈ 10 µM
Elution MethodsImidazole (150–500 mM), low pH (4–5), or EDTA

Key Applications

  • Mechanistic Studies: Used to dissect ABC transporter dynamics and substrate specificity .

  • Drug Discovery: Target for antimicrobial agents disrupting amino acid uptake .

  • Protein-Protein Interaction Analysis: Employed in BLI assays (e.g., Octet® HIS1K Biosensors) to study binding kinetics .

Purification Workflow

The His-Spin Protein Miniprep (Zymo Research) exemplifies a high-efficiency protocol:

ParameterDetail
Binding CapacityUp to 1 mg protein
Elution Volume100–200 µl
Purity≥85% (SDS-PAGE verified)
Time5 minutes

Optimization Tips:

  • For insoluble proteins, use denaturing conditions (e.g., urea or guanidine HCl) .

  • Adjust imidazole concentrations in wash buffers to enhance yield .

Functional Insights

  • Phosphorylation Dynamics: While HisQ itself is not a kinase, studies on homologous systems (e.g., AtoS-AtoC) reveal histidine phosphorylation’s role in signal transduction, informing transporter regulation models .

  • Structural Flexibility: Mutagenesis studies suggest HisQ’s transmembrane helices undergo conformational shifts during substrate translocation .

Challenges and Solutions

IssueResolution
Low YieldIncrease starting material concentration or use denaturing buffers .
Non-Specific BindingOptimize wash buffer imidazole (e.g., reduce to 25 mM) .
Tag InaccessibilityUse epitope-specific antibodies (e.g., Penta-His) for detection in complex lysates .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for customers.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
hisQ; b2308; JW2305; Histidine transport system permease protein HisQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
hisQ
Target Protein Sequence
MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVP DLVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP KGHIEAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKAT QLAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKRADL
Uniprot No.

Target Background

Function
This protein serves as part of the histidine permease ABC transporter and is also involved in a lysine/arginine/ornithine transporter. It is likely responsible for translocating the substrate across the membrane. Additionally, it plays a crucial role in relaying the ATPase-inducing signal from the solute-binding protein to HisP.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the histidine transport system permease protein hisQ?

HisQ is a hydrophobic membrane protein that forms part of the histidine permease system in E. coli. Based on studies in Salmonella typhimurium, which has a highly similar system, HisQ functions in combination with HisM (another hydrophobic membrane protein) and HisP (a nucleotide-binding membrane protein) to form the Q/M/P membrane-bound complex. This complex facilitates the transport of histidine from the periplasmic space into the bacterial cytoplasm .

How does hisQ contribute to the histidine transport mechanism?

HisQ spans the bacterial membrane and interacts directly with the histidine-binding protein HisJ, which captures histidine in the periplasmic space. This interaction initiates conformational changes in the membrane complex, allowing the formation of either a specific pore for histidine passage or substrate-binding sites that transfer histidine through the membrane. The transport process is energized by ATP hydrolysis, with the HisP component of the complex likely coupling this energy to transport .

What protein interactions are essential for hisQ function?

HisQ engages in multiple protein-protein interactions that are essential for transport activity:

  • Direct interaction with HisJ (histidine-binding protein) has been demonstrated through binding studies

  • Forms a complex with HisM and HisP (the Q/M/P complex), verified by cross-linking and coimmunoprecipitation experiments

  • May interact indirectly with the LAO (lysine-, arginine-, ornithine-binding) protein, which can also facilitate histidine transport through the same system

What are the optimal conditions for recombinant hisQ expression in E. coli?

For successful expression of recombinant hisQ, researchers should consider the following optimized protocol:

  • Bacterial strain selection: Utilize RosettaTM 2(DE3) cells which supply tRNAs for rare codons that may be present in the hisQ gene

  • Growth conditions:

    • Initialize growth at 37°C to mid-log phase (OD600 ~0.5)

    • Reduce temperature to 30°C immediately before induction

    • Add IPTG to a final concentration of 1 mM

    • Continue expression for 4 hours post-induction

  • Media and supplements:

    • LB medium with appropriate antibiotics (ampicillin at 100 μg/ml and chloramphenicol at 30 μg/ml for Rosetta cells)

How can researchers address the insolubility challenges of recombinant hisQ?

As a membrane protein, hisQ presents significant solubility challenges. Multiple approaches can be implemented to improve solubility:

  • Fusion tag strategy: Employ a His6-MBP (hexahistidine-maltose binding protein) tag system, which provides both solubility enhancement and purification capability

  • Temperature optimization: Reduce induction temperature to 30°C or lower (18-20°C) to slow protein synthesis and allow proper folding

  • Induction control: Lower IPTG concentrations (0.1-0.5 mM) can result in slower, more controlled expression

  • Detergent selection: Screen multiple detergents (DDM, LDAO, OG) for optimal solubilization of membrane-integrated hisQ

  • Co-expression strategies: Express hisQ alongside other components of the histidine transport system to promote proper complex formation

What is the most effective cloning strategy for generating functional hisQ constructs?

The Gateway® recombinational cloning system offers significant advantages for hisQ construct generation:

  • Entry clone creation (BP reaction):

    • Design PCR primers containing attB sites flanking the hisQ gene

    • Amplify hisQ with the attB sites

    • Combine PCR product with donor vector (pDONR221)

    • Add BP Clonase II enzyme mix and incubate for ≥4 hours

    • Transform into E. coli and select with appropriate antibiotic

  • Expression clone generation (LR reaction):

    • Mix entry clone with destination vector (pDEST566 for His6-MBP fusion or pDEST527 for His6 fusion)

    • Add LR Clonase II enzyme mix and incubate for 2 hours

    • Transform into E. coli and select with ampicillin

  • Sequence verification: Confirm the final construct by sequencing to ensure no mutations were introduced during cloning

How can researchers establish a reliable histidine transport assay system?

A comprehensive transport assay for evaluating hisQ function requires:

  • Cell preparation:

    • Express wild-type or mutant hisQ constructs in an appropriate E. coli strain

    • Harvest cells in mid-log phase (OD600 ~0.5)

    • Wash cells and resuspend in minimal medium without carbon or nitrogen sources

  • Transport measurement:

    • Add radiolabeled L-histidine ([14C] or [3H]) to a final concentration of 0.1-10 μM

    • Incubate at 37°C with gentle agitation

    • At timed intervals (15, 30, 60, 120 seconds), remove aliquots and filter cells

    • Wash filters to remove unincorporated histidine

    • Measure cell-associated radioactivity using a scintillation counter

  • Data analysis:

    • Calculate initial transport rates (nmol/mg protein/min)

    • For kinetic analysis, vary histidine concentrations to determine Km and Vmax values

    • Compare transport rates between wild-type and mutant constructs

What mutations in hisQ significantly impact transport function?

Research with the histidine transport system has identified several types of functionally significant mutations:

  • Binding-protein independent mutations:

    • Mutations that allow transport in the absence of histidine-binding proteins (HisJ and LAO)

    • These mutations suggest HisQ contains substrate specificity determinants and potential histidine binding sites

  • HisJ interaction interface mutations:

    • Mutations at the periplasmic interface can disrupt the critical interaction with HisJ

    • These mutations help identify the binding interface between HisQ and the binding protein

  • Pore-forming region mutations:

    • Alterations in transmembrane domains can affect channel formation

    • Such mutations may change pore size, shape, or hydrophobicity

Mutation TypeFunctional ImpactResearch Application
Binding-protein independentEnables transport without HisJ/LAOIdentifies substrate pathway
Interface mutationsDisrupts HisJ interactionMaps protein-protein contacts
Transmembrane mutationsAlters channel propertiesDefines transport pathway
Kinetic mutationsChanges transport ratesIdentifies rate-limiting steps

How can researchers distinguish between direct and indirect effects of hisQ mutations?

To differentiate direct functional impacts from secondary effects:

  • Protein expression verification:

    • Confirm mutant hisQ is expressed at levels comparable to wild-type

    • Use western blotting with anti-His or other appropriate antibodies

    • Verify membrane localization using fractionation techniques

  • Interaction analysis:

    • Assess binding to HisJ using co-precipitation or cross-linking methods

    • Compare binding affinities between wild-type and mutant hisQ

  • Complementation studies:

    • Express mutant hisQ in strains lacking endogenous histidine transport

    • Measure growth rates on minimal media with histidine as sole nitrogen source

    • Compare complementation efficiency with wild-type hisQ

  • In vitro reconstitution:

    • Purify mutant and wild-type hisQ

    • Reconstitute in proteoliposomes with other complex components

    • Measure transport activity in the controlled system

What approaches are most promising for determining hisQ membrane topology?

Multiple complementary methods should be employed to establish accurate membrane topology:

  • Computational prediction:

    • Utilize membrane protein topology prediction algorithms (TMHMM, Phobius, TOPCONS)

    • Compare predictions from multiple algorithms to identify consensus transmembrane regions

  • Reporter fusion strategy:

    • Create systematic truncations of hisQ fused to reporter proteins

    • Use alkaline phosphatase (PhoA, active in periplasm) or green fluorescent protein (GFP, fluorescent in cytoplasm)

    • Map topology based on activity/fluorescence patterns of the fusion series

  • Cysteine accessibility method:

    • Generate a cysteine-free hisQ variant

    • Introduce single cysteines at predicted loop regions

    • Treat with membrane-permeable and membrane-impermeable sulfhydryl reagents

    • Analyze labeling patterns to determine residue accessibility

  • Limited proteolysis:

    • Prepare membrane vesicles with defined orientation

    • Treat with proteases

    • Identify protected fragments by mass spectrometry or western blotting

What strategies can overcome the challenges in crystallizing hisQ for structural studies?

Membrane protein crystallization faces unique obstacles requiring specialized approaches:

  • Construct optimization:

    • Remove flexible regions that may hinder crystallization

    • Create fusion proteins with crystallization chaperones (T4 lysozyme, BRIL)

    • Try both N- and C-terminal His-tags to identify optimal construct

  • Detergent screening:

    • Systematically test multiple detergents (DDM, LDAO, OG, UDM)

    • Evaluate protein stability in each detergent using size-exclusion chromatography

    • Consider novel amphipathic agents like maltose-neopentyl glycol (MNG)

  • Advanced crystallization methods:

    • Lipidic cubic phase (LCP) crystallization specifically designed for membrane proteins

    • Antibody fragment co-crystallization to provide crystal contacts

    • Nanobody-assisted crystallization to stabilize specific conformations

  • Alternative structural approaches:

    • Cryo-electron microscopy of the entire Q/M/P complex

    • Solid-state NMR of reconstituted hisQ in lipid bilayers

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

How can researchers design experiments to study conformational changes in hisQ during transport?

Multiple biophysical techniques can capture the dynamic conformational states:

  • Site-specific fluorescence labeling:

    • Introduce single cysteines at strategic positions

    • Label with environment-sensitive fluorophores (IAEDANS, bimane)

    • Monitor fluorescence changes during transport cycle

    • For distance measurements, use FRET pairs at two positions

  • EPR spectroscopy approaches:

    • Label cysteines with spin labels (MTSL)

    • Use continuous wave EPR to monitor local environment

    • Apply double electron-electron resonance (DEER) for precise distance measurements

    • Compare distances in substrate-bound, nucleotide-bound, and apo states

  • Disulfide cross-linking strategy:

    • Introduce cysteine pairs at positions predicted to approach during transport

    • Measure spontaneous disulfide formation under various conditions

    • Use oxidizing/reducing agents to trap specific conformations

    • Analyze trapped conformations by functional assays

  • Time-resolved methods:

    • Develop rapid mixing experiments with stopped-flow fluorescence

    • Correlate conformational changes with transport steps

    • Identify rate-limiting conformational transitions

How does hisQ compare structurally and functionally to homologous transport proteins?

Comparative analysis provides evolutionary and mechanistic insights:

  • Sequence conservation patterns:

    • Align hisQ sequences across bacterial species

    • Identify highly conserved residues likely critical for function

    • Map conservation onto predicted structural elements

    • Compare conservation between histidine and other amino acid transporters

  • Functional conservation assessment:

    • Test cross-species complementation with hisQ homologs

    • Compare transport kinetics between homologous systems

    • Identify species-specific adaptations in transport efficiency

  • Structural comparison with related transporters:

    • Compare membrane topology with other bacterial permeases

    • Analyze similarities in pore-forming regions

    • Identify conserved motifs for binding protein interaction

    • Examine differences that may account for substrate specificity

Transport SystemSubstrateKey Differences from HisQShared Mechanisms
Maltose permease (MalF)MaltoseDifferent substrate specificityABC transporter architecture
Arginine permease (ArtQ)ArginineDifferent binding proteinATP-dependent energization
Oligopeptide permease (OppB)PeptidesLarger substrate channelPeriplasmic binding protein interaction

What protein engineering approaches can enhance hisQ stability for biochemical studies?

Improving stability is critical for structural and functional analysis:

  • Thermostabilizing mutations:

    • Introduce disulfide bonds to restrict flexibility

    • Replace surface-exposed hydrophobic residues

    • Fill internal cavities with hydrophobic substitutions

    • Test each mutation for maintained transport function

  • Fusion partner strategies:

    • Employ MBP fusions to enhance solubility

    • Test BRIL (apocytochrome b562RIL) insertions in loop regions

    • Consider T4 lysozyme fusions at termini or loops

  • Consensus-based engineering:

    • Identify consensus sequences from multiple bacterial species

    • Introduce consensus residues at variable positions

    • Test combinatorial consensus mutations for additive effects

  • Co-expression with stabilizing partners:

    • Express with antibody fragments that bind and stabilize

    • Co-express with other components of the Q/M/P complex

    • Include molecular chaperones to improve folding

How can isotope labeling enhance NMR studies of hisQ dynamics?

Nuclear magnetic resonance studies require specialized labeling approaches:

  • Selective amino acid labeling:

    • Label only specific amino acids (Leu, Val, Ile, Met) with 15N or 13C

    • Focus on residues in predicted functional sites

    • Simplifies complex spectra of membrane proteins

    • Allows monitoring of specific regions during transport

  • Methyl-TROSY approach:

    • Label methyl groups in Ile, Leu, Val residues

    • Use deuteration of non-methyl positions

    • Methyl groups provide excellent NMR probes due to favorable relaxation

    • Effective for large membrane protein complexes

  • Segmental labeling strategies:

    • Label only specific domains through protein splicing techniques

    • Isolate signals from functionally important regions

    • Reduce spectral complexity for focused analysis

  • Membrane mimetic optimization:

    • Test various membrane mimetics (detergents, bicelles, nanodiscs)

    • Optimize conditions for maintaining native-like dynamics

    • Balance mimetic size with spectral quality

How can researchers address low yield and aggregation during recombinant hisQ expression?

Common challenges with membrane protein expression require systematic troubleshooting:

  • Expression optimization:

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta strains)

    • Screen growth temperatures (18°C, 25°C, 30°C, 37°C)

    • Vary induction conditions (IPTG concentration 0.1-1.0 mM)

    • Try auto-induction media for gradual protein expression

  • Solubility enhancement:

    • Use His6-MBP dual tag system for improved solubility

    • Try additional solubilizing tags (SUMO, TrxA, GST)

    • Test different lysis and solubilization buffers with various detergents

    • Consider co-expression with other permease components

  • Aggregation prevention:

    • Add stabilizing agents (glycerol 10-20%, arginine 50-200 mM)

    • Include specific ligands or substrate analogs during purification

    • Optimize detergent:protein ratio during solubilization

    • Maintain samples at 4°C throughout processing

ProblemPotential SolutionImplementation
Low expressionTest C41/C43 strainsDesigned for toxic membrane proteins
Inclusion bodiesLower induction temperature to 18°CSlow expression improves folding
Aggregation during purificationAdd 10% glycerol to all buffersStabilizes hydrophobic interfaces
Poor solubilizationScreen detergent panelTest DDM, LDAO, OG, and FC-12

What controls are essential for validating hisQ functional studies?

Rigorous experimental controls ensure reliable functional data:

  • Expression controls:

    • Verify expression levels of wild-type and mutant proteins

    • Confirm membrane localization by fractionation

    • Check protein integrity by western blotting

    • Quantify surface exposure using membrane-impermeable labeling

  • Functional controls:

    • Include known non-functional mutants as negative controls

    • Use strains lacking endogenous transport systems

    • Measure transport of unrelated substrates to confirm specificity

    • Include competition assays with unlabeled substrates

  • System-specific controls:

    • Test transport in the presence/absence of histidine-binding proteins

    • Examine ATP-dependence using non-hydrolyzable analogs

    • Verify complex formation between hisQ and other permease components

    • Use specific inhibitors when available

  • Technical controls:

    • Perform time-course measurements to ensure linear initial rates

    • Include substrate-free blanks to measure background

    • Run parallel assays at different temperatures to verify activity

    • Normalize transport rates to expression levels

What emerging technologies could advance understanding of hisQ structure and function?

Several cutting-edge approaches show promise for hisQ research:

  • Cryo-electron microscopy:

    • Single-particle cryo-EM for high-resolution structures

    • Capture different conformational states during transport

    • Visualize the complete Q/M/P complex architecture

    • Potentially observe binding protein interactions

  • Native mass spectrometry:

    • Analyze intact membrane protein complexes

    • Determine subunit stoichiometry

    • Identify lipid interactions critical for function

    • Probe ligand binding under near-native conditions

  • Single-molecule techniques:

    • FRET measurements on individual transporters

    • Direct observation of conformational dynamics

    • Correlation of ATP hydrolysis with transport events

    • Real-time monitoring of transport cycles

  • Computational approaches:

    • Molecular dynamics simulations of transport process

    • Machine learning models to predict functional residues

    • Advanced homology modeling with related transporters

    • In silico screening for potential inhibitors

How might genetic approaches enhance the study of hisQ function in vivo?

Advanced genetic tools offer new insights into physiological roles:

  • CRISPR-based approaches:

    • Generate precise chromosomal mutations

    • Create conditional expression systems

    • Perform high-throughput screening of mutant libraries

    • Implement CRISPRi for tunable repression

  • In vivo crosslinking methods:

    • Incorporate unnatural amino acids at specific positions

    • Perform photo-crosslinking in living cells

    • Identify transient interaction partners

    • Capture dynamic complexes during transport

  • Reporter systems:

    • Develop fluorescent sensors for histidine transport

    • Create growth-coupled selection systems for functional variants

    • Implement split-protein complementation to monitor complex formation

    • Use riboswitch-based reporters for high-throughput screening

  • Systems biology integration:

    • Analyze hisQ function in different metabolic states

    • Examine cross-talk with other transport systems

    • Study regulation in response to environmental conditions

    • Investigate fitness contributions in various growth environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.