Recombinant Escherichia coli Homoserine/homoserine lactone efflux protein (rhtB)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant RhtB (UniProt ID: P0AG34) is a full-length, His-tagged protein expressed in E. coli . It consists of 206 amino acids, with a molecular weight consistent with its role as a transmembrane efflux pump . Key characteristics include:

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended for long-term storage

Genetic and Regulatory Features

  • Gene: rhtB (synonyms: yigK, b3824) .

  • Expression Regulation:

    • Controlled by the global regulator Lrp (Leucine-responsive regulatory protein) .

    • Induced by amino acid availability (e.g., leucine, threonine) and stress conditions (e.g., heat shock, oxidative stress) .

Key Research Findings

StudyKey ContributionSource
Functional CharacterizationrhtB amplification confers resistance to homoserine and homoserine lactone .
Regulatory AnalysisLrp-dependent expression modulation under amino acid availability and stress .
Structural ClassificationClassification within TC# 2.A.76 and homology to LysE superfamily transporters .

Applications and Industrial Relevance

  • Metabolic Engineering: Overexpression of RhtB enhances bacterial tolerance to toxic amino acid byproducts, optimizing fermentation processes .

  • Drug Discovery: Serves as a model for studying multidrug resistance mechanisms in pathogenic bacteria .

Production and Quality Control

Recombinant RhtB is typically produced via E. coli expression systems, followed by affinity chromatography (His-tag purification) . Critical quality metrics include:

  • Sequence Verification: Full-length AA sequence confirmed by mass spectrometry .

  • Activity Assays: Functional validation via efflux assays using radiolabeled homoserine .

Challenges and Future Directions

  • Structural Resolution: No crystallographic data available; further studies needed to elucidate transport mechanics.

  • Substrate Specificity: Broader profiling required to identify additional efflux targets .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
rhtB; yigK; b3824; JW5585; Homoserine/homoserine lactone efflux protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
rhtB
Target Protein Sequence
MTLEWWFAYLLTSIILSLSPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVG LGTLFSRSVIAFEVLKWAGAAYLIWLGIQQWRAAGAIDLKSLASTQSRRHLFQRAVFVNL TNPKSIVFLAALFPQFIMPQQPQLMQYIVLGVTTIVVDIIVMIGYATLAQRIALWIKGPK QMKALNKIFGSLFMLVGALLASARHA
Uniprot No.

Target Background

Function
Facilitates the efflux of homoserine and homoserine lactone.
Database Links
Protein Families
Rht family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are commonly used for recombinant rhtB production?

The production of recombinant rhtB can be accomplished through multiple expression systems, with the most common being:

  • E. coli expression system: Despite rhtB being native to E. coli, it is often expressed recombinantly in E. coli expression vectors. When expressed in its native host, the protein frequently forms inclusion bodies after induction with 1 mM IPTG at 37°C . This method typically yields 80-100 mg/L of protein .

  • Yeast expression systems: Pichia pastoris has been used as an alternative expression system for similar membrane proteins. For comparable proteins like LTB (heat-labile enterotoxin B subunit), expression in P. pastoris resulted in higher yields (250-300 mg/L) compared to E. coli systems .

  • Baculovirus expression systems: For certain applications requiring post-translational modifications, baculovirus-insect cell systems may be employed .

The choice of expression system should align with experimental goals, considering factors such as protein folding requirements, post-translational modifications, and downstream applications.

What are the standard storage conditions for recombinant rhtB protein?

Proper storage of recombinant rhtB is critical for maintaining its structural integrity and functional properties. Based on standard protocols, the recommended storage conditions are:

  • Store at -20°C for regular use, or -80°C for extended storage

  • Use a storage buffer typically consisting of Tris-based buffer with 50% glycerol, optimized for the protein's stability

  • Avoid repeated freeze-thaw cycles, as this can significantly compromise protein stability

  • For short-term use, working aliquots can be stored at 4°C for up to one week

When preparing the protein for storage, it's advisable to divide the stock into small working aliquots to minimize the number of freeze-thaw cycles.

How can researchers design experiments to assess rhtB function?

Designing experiments to evaluate rhtB function requires careful consideration of appropriate controls and measurement techniques. A comprehensive experimental approach might include:

  • Transport activity assays: Design assays to measure the efflux of homoserine and homoserine lactone across membranes. This typically involves:

    • Loading vesicles containing recombinant rhtB with labeled substrates

    • Monitoring substrate concentrations inside and outside the vesicles over time

    • Comparing transport rates with negative controls (vesicles without rhtB)

  • Binding assays: Assess substrate binding using techniques such as:

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

    • Fluorescence-based binding assays

  • Mutational analysis: Implement experimental designs that include:

    • Site-directed mutagenesis of key residues

    • Expression of mutant proteins using the same systems as wild-type

    • Comparative analysis of transport activity between mutants and wild-type

  • Inhibitor studies: Test potential inhibitors of rhtB transport function using:

    • Concentration-dependent inhibition assays

    • Competition assays with known substrates

When designing these experiments, researchers should consider using randomized controlled trial (RCT) approaches where possible, as these provide the strongest evidence for causality and minimize bias .

What experimental designs are most effective for comparing rhtB expression across different systems?

When comparing rhtB expression across different systems (e.g., E. coli vs. P. pastoris), researchers should consider implementing quasi-experimental or fully experimental designs:

Experimental design approach:

  • Standardize the recombinant gene construct across expression systems

  • Implement controlled variables (temperature, induction conditions, media composition)

  • Measure expression levels using consistent quantification methods

  • Assess protein functionality using standardized assays

A data table for such comparisons might be structured as follows:

Expression SystemExpression ConditionsYield (mg/L)Purification MethodPurity (%)Functionality Assay Results
E. coli1 mM IPTG, 37°C80-100Affinity chromatography95%[Assay result]
P. pastoris0.5% methanol, 30°C250-300Affinity chromatography95%[Assay result]
Baculovirus[Conditions][Yield][Method][Purity][Assay result]

This experimental design allows for direct comparison of expression efficiency while controlling for variables that might influence results .

How should researchers design controls when studying rhtB function?

Proper control design is essential for rigorous investigation of rhtB function. Researchers should implement:

  • Negative controls:

    • Empty vector controls (expression systems without the rhtB gene)

    • Vesicles or cells without rhtB expression

    • Inactive mutant versions of rhtB (site-directed mutagenesis of key residues)

  • Positive controls:

    • Known functional transporters with similar activities

    • Purified rhtB protein with confirmed activity

    • Commercially available reference standards

  • Internal controls:

    • Housekeeping proteins for expression normalization

    • Standard concentration curves for quantification

    • Time-course controls to establish baseline kinetics

  • Technical controls:

    • Multiple biological replicates (minimum three)

    • Technical replicates for each measurement

    • Randomization of sample processing order

Implementing these controls within a randomized controlled experimental design provides the most reliable results and minimizes the influence of confounding variables .

What purification strategies yield the highest purity of recombinant rhtB?

Achieving high purity of recombinant rhtB requires optimization of purification protocols. The most effective strategies typically involve:

  • Affinity chromatography: For His-tagged rhtB, nickel or cobalt affinity columns are most commonly employed, yielding purities up to 95% . This approach leverages the strong interaction between the His-tag and immobilized metal ions.

  • Size exclusion chromatography (SEC): Following initial purification, SEC can be used to separate rhtB from contaminants of different molecular weights and to assess protein homogeneity.

  • Ion exchange chromatography: This can be used as an additional purification step to remove contaminants with different charge properties.

A typical purification workflow might include:

  • Cell lysis under conditions that maintain protein stability

  • Clarification of lysate by centrifugation and filtration

  • Affinity chromatography using appropriate binding and elution buffers

  • Desalting or buffer exchange

  • Secondary purification methods (SEC or ion exchange)

  • Concentration and final buffer exchange

For membrane proteins like rhtB, addition of detergents throughout the purification process is often necessary to maintain solubility and prevent aggregation.

What analytical techniques are most effective for characterizing recombinant rhtB?

Comprehensive characterization of recombinant rhtB requires multiple analytical approaches:

  • SDS-PAGE and Western blot: For assessing purity, apparent molecular weight, and confirming identity using specific antibodies .

  • Mass spectrometry:

    • Electrospray ionization mass spectrometry (ESI-MS) for accurate molecular weight determination

    • Liquid chromatography-mass spectrometry (LC-MS) for peptide analysis and sequence confirmation

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for structural dynamics studies

  • Circular dichroism (CD) spectroscopy: To evaluate secondary structure content and thermal stability.

  • Functional assays:

    • Transport assays using reconstituted proteoliposomes

    • Substrate binding assays (e.g., isothermal titration calorimetry)

  • Structural analysis:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy

    • Nuclear magnetic resonance (NMR) for dynamics studies

Each analytical technique provides different information about the protein, and combining multiple approaches yields the most comprehensive characterization.

How can researchers assess the functionality of purified rhtB protein?

Assessing the functionality of purified rhtB protein is crucial to confirm that the recombinant protein retains its native activity. Recommended approaches include:

  • Reconstitution into liposomes: Incorporate purified rhtB into artificial lipid bilayers to create proteoliposomes that mimic the natural membrane environment.

  • Transport assays:

    • Measure the uptake or efflux of labeled homoserine/homoserine lactone

    • Compare transport rates with those of control liposomes (without rhtB)

    • Assess the effect of inhibitors or competitive substrates

  • Binding assays:

    • Isothermal titration calorimetry to measure substrate binding affinities

    • Fluorescence-based assays with labeled substrates

    • Surface plasmon resonance to determine association/dissociation kinetics

  • ATPase activity (if applicable): Measure ATP hydrolysis rates in the presence of transport substrates.

The functionality assessment should include appropriate positive and negative controls, and statistical analysis should be performed to ensure reproducibility and significance of results.

How does post-translational modification affect rhtB function when expressed in different systems?

The impact of post-translational modifications (PTMs) on rhtB function is an important consideration when selecting expression systems:

  • Glycosylation patterns: When expressed in yeast systems like P. pastoris, proteins may undergo glycosylation that alters their molecular weight compared to E. coli expression. For instance, similar proteins expressed in P. pastoris showed increased molecular weight compared to the expected size when expressed in E. coli .

  • Functional implications: These modifications can significantly impact:

    • Protein stability and solubility

    • Binding affinities for substrates

    • Transport kinetics and efficiency

    • Immunogenicity (relevant for certain applications)

  • Analysis of PTMs: Researchers should employ:

    • Mass spectrometry to identify and characterize modifications

    • Enzymatic treatments to remove specific modifications

    • Comparative functional assays between modified and unmodified proteins

When investigating PTM effects, experimental designs should include thorough controls and comparative analyses between expression systems to isolate the specific impacts of the modifications on protein function.

What are the most effective experimental designs for investigating rhtB substrate specificity?

Investigating rhtB substrate specificity requires systematic experimental approaches:

  • Competitive transport assays:

    • Measure transport of known substrates in the presence of potential alternative substrates

    • Calculate inhibition constants (Ki) for different compounds

    • Determine structure-activity relationships among substrates

  • Direct binding measurements:

    • Isothermal titration calorimetry to measure binding affinities (Kd) for various substrates

    • Surface plasmon resonance to determine association and dissociation rates

    • Fluorescence-based binding assays for high-throughput screening

  • Structural biology approaches:

    • Co-crystallization with different substrates

    • Cryo-EM studies of protein-substrate complexes

    • Molecular dynamics simulations to predict binding modes

  • Mutagenesis studies:

    • Targeted mutations of predicted binding site residues

    • Functional analysis of mutants with altered substrate specificity

    • Construction of chimeric proteins with related transporters

A quasi-experimental design approach is often suitable for these studies, particularly when randomization is not feasible due to the nature of the experiments .

How can researchers design experiments to investigate the relationship between rhtB structure and function?

Structure-function relationship studies for rhtB should employ a combination of experimental approaches:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified through sequence alignment

    • Focus on predicted transmembrane regions and substrate binding sites

    • Create systematic alanine-scanning libraries

    • Generate mutations that alter charge, hydrophobicity, or size at key positions

  • Functional impact assessment:

    • Compare transport kinetics (Km, Vmax) between wild-type and mutant proteins

    • Measure changes in substrate specificity

    • Assess protein stability and membrane integration

  • Structural analysis:

    • Use circular dichroism to detect changes in secondary structure

    • Apply hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Implement crosslinking studies to determine proximity relationships

    • Pursue crystallization or cryo-EM for direct structural determination

  • Computational approaches:

    • Homology modeling based on related transporters with known structures

    • Molecular dynamics simulations of substrate transport

    • Prediction of conformational changes during transport cycle

This multi-faceted experimental design allows researchers to correlate specific structural elements with functional properties, providing insights into the transport mechanism.

What statistical approaches are most appropriate for analyzing rhtB functional data?

  • For transport kinetics data:

    • Non-linear regression for determining Michaelis-Menten parameters (Km, Vmax)

    • Statistical comparison of parameters between experimental conditions using t-tests or ANOVA

    • Evaluation of inhibition constants using appropriate inhibition models

  • For comparative studies across expression systems:

    • ANOVA with post-hoc tests for comparing multiple systems

    • Multiple regression to account for confounding variables

    • Mixed effects models for repeated measures designs

  • For structure-function relationship studies:

    • Correlation analyses between structural parameters and functional outputs

    • Principal component analysis to identify patterns in multivariate data

    • Cluster analysis to group mutations by functional effects

  • For experimental designs with time series data:

    • Interrupted time series analysis for detecting intervention effects

    • Repeated measures ANOVA for time-course experiments

    • Area under the curve (AUC) calculations for cumulative effects

When reporting results, researchers should provide complete statistical information, including test statistics, degrees of freedom, p-values, and effect sizes .

How should researchers address contradictory findings in rhtB characterization studies?

Addressing contradictions in research findings requires systematic investigation:

  • Methodological reconciliation approach:

    • Compare experimental conditions across studies in detail

    • Identify differences in expression systems, purification methods, or assay conditions

    • Replicate key experiments using standardized protocols

    • Conduct side-by-side comparisons of different methods

  • Statistical considerations:

    • Perform meta-analysis of available data when multiple studies exist

    • Evaluate statistical power in contradictory studies

    • Consider Bayesian approaches to integrate prior knowledge with new data

  • Biological explanations:

    • Investigate protein isoforms or post-translational modifications

    • Consider the impact of experimental conditions on protein conformation

    • Examine the influence of membrane composition on protein function

  • Reconciliation experiments:

    • Design studies specifically to address the contradictions

    • Include positive and negative controls from both sides of the contradiction

    • Implement blinded analysis to minimize bias

This structured approach helps researchers determine whether contradictions arise from methodological differences, statistical issues, or genuine biological complexity.

What are the best practices for reporting rhtB experimental data in scientific publications?

Comprehensive reporting of rhtB experimental data should follow these guidelines:

  • Methods documentation:

    • Provide complete sequence information, including any tags or modifications

    • Detail expression conditions (induction method, temperature, duration)

    • Describe purification protocols with buffer compositions

    • Specify analytical methods with instrument parameters

  • Results presentation:

    • Include representative images of SDS-PAGE and Western blots

    • Present raw data for functional assays when possible

    • Use appropriate graphical representations (scatter plots for individual data points)

    • Provide statistical analysis details (tests used, p-values, confidence intervals)

  • Data tables:

    • Summarize key parameters (yield, purity, activity) across experimental conditions

    • Include sample sizes and replication information

    • Report both mean values and measures of variability (standard deviation or standard error)

An example data table format:

ExperimentExpression SystemYield (mg/L)Purity (%)Km for Homoserine (μM)Vmax (nmol/min/mg)n
Wild-type rhtBE. coli BL21(DE3)95 ± 597 ± 2125 ± 1545 ± 56
K45A MutantE. coli BL21(DE3)90 ± 796 ± 3350 ± 3040 ± 66
Wild-type rhtBP. pastoris275 ± 2595 ± 3110 ± 1250 ± 76
  • Accessibility considerations:

    • Deposit raw data in appropriate repositories

    • Provide clear figure legends that stand alone from the text

    • Make materials available to other researchers upon reasonable request

Following these reporting practices enhances reproducibility and enables more effective comparison across studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.