Recombinant Escherichia coli Inner membrane amino-acid ABC transporter permease protein yecS (yecS)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tcyL; yecS; b1918; JW1903; L-cystine transport system permease protein TcyL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yecS
Target Protein Sequence
MQESIQLVIDSLPFLLKGAGYTLQLSIGGMFFGLLLGFILALMRLSPIWPVRWLARFYIS
IFRGTPLIAQLFMIYYGLPQFGIELDPIPSAMIGLSLNTAAYAAETLRAAISSIDKGQWE
AAASIGMTPWQTMRRAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITS
RTLEVFTMYLAASLIYWIMATVLSTLQNHFENQLNRQEREPK
Uniprot No.
Target Background
Function
The recombinant *Escherichia coli* inner membrane amino-acid ABC transporter permease protein YecS is part of the TcyJLN transporter complex involved in L-cystine import. This high-affinity transporter contributes to oxidative stress resistance by participating in an L-cysteine/L-cystine shuttle system with the EamA transporter. EamA exports L-cysteine as reducing equivalents to the periplasm, mitigating oxidative stress. The exported L-cysteine reduces periplasmic hydrogen peroxide to water, and the resulting L-cystine is then imported back into the cytoplasm via the TcyJLN complex. YecS functions optimally at low cystine concentrations. This system also transports L-cysteine, diaminopimelic acid (DAP), djenkolate, lanthionine, D-cystine, homocystine, and mediates the accumulation of toxic compounds L-selenaproline (SCA) and L-selenocystine (SeCys). Its primary function is the transmembrane translocation of the substrate.
Database Links
KEGG: ecj:JW1903
STRING: 316385.ECDH10B_2059
Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
