Recombinant Escherichia coli Inner membrane lipoprotein YiaD (yiaD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in your order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yiaD; b3552; JW5657; Probable lipoprotein YiaD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-219
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yiaD
Target Protein Sequence
CTTNPYTGEREAGKSAIGAGLGSLVGAGIGALSSSKKDRGKGALIGAAAGAALGGGVGYY MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASRIRTQGLGPANPIASN STAEGKAQNRRVEITLSPL
Uniprot No.

Target Background

Function
Overexpression suppresses temperature-sensitive mutations in BamB.
Database Links
Protein Families
OmpA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Cell outer membrane; Lipid-anchor.

Q&A

What is the genomic context of YiaD in Escherichia coli?

YiaD in E. coli is part of a conserved genomic region. Similar to other membrane proteins like YidC (which is located in a gene cluster that includes rpmH, rnpA, yidD, yidC, and trmE), YiaD's genomic context provides important clues about its functional relationships . When investigating YiaD, it's essential to consider:

  • Upstream and downstream genes that may be co-regulated

  • Promoter elements and transcription factor binding sites

  • Conservation patterns across different E. coli strains and other enteric bacteria

  • Potential operon structures that could indicate functional relationships

Methodologically, researchers should employ comparative genomics approaches using databases like EcoCyc, KEGG, and STRING to visualize genomic context and identify potentially related proteins before embarking on experimental studies.

What are the structural characteristics of YiaD as an inner membrane lipoprotein?

YiaD belongs to the class of bacterial lipoproteins that associate with the inner membrane through lipid modifications. As a lipoprotein, YiaD likely contains:

  • An N-terminal signal sequence with a lipobox motif (typically L-[A/S/T]-[G/A]-C)

  • A conserved cysteine residue that becomes lipid-modified

  • Membrane-associated regions potentially including amphipathic helices

The structural analysis of YiaD should include prediction tools for secondary structures, hydrophobicity analysis, and comparison with other characterized inner membrane lipoproteins. Experimental approaches would typically involve membrane fractionation followed by proteomic analysis to confirm localization.

What expression systems are most suitable for recombinant YiaD production?

For effective recombinant production of YiaD, consider the following methodological approach:

Expression System ComponentRecommended OptionsRationale
Host strainE. coli BL21(DE3), C43(DE3), or C41(DE3)These strains are engineered for membrane protein expression
VectorpET series with periplasmic targetingAllows for proper processing of the lipoprotein
PromoterT7, rhamnose-inducible (pRha)Tunable expression to prevent toxicity
Signal peptideDsbA, OmpA, PhoA, or HbpThese signal peptides can efficiently target to the membrane/periplasm
Induction conditionsLow temperature (16-25°C), low inducer concentrationPrevents formation of inclusion bodies

When expressing membrane lipoproteins like YiaD, optimizing translational rates rather than maximizing expression is critical for proper membrane insertion and folding . Consider using tunable promoters like the rhamnose-inducible system where production rates can be precisely controlled by varying rhamnose concentration, as shown successful for other periplasmic proteins .

How does the interaction between YiaD and the Sec/YidC pathway affect membrane insertion efficiency?

The insertion of YiaD into the inner membrane likely involves the Sec translocon and potentially YidC, which acts as a membrane protein insertase and foldase. Based on studies of similar membrane proteins:

  • YiaD translocation may follow either a strictly Sec-dependent pathway or a combined Sec-YidC pathway, similar to how YidC can function both in conjunction with and independently of the Sec translocon for different substrates .

  • The efficiency of YiaD membrane insertion can be assessed using in vitro cross-linking experiments to determine proximity to translocon components during insertion, similar to methods used to study YidD's role in membrane protein insertion .

  • Depletion studies using conditional expression of Sec components or YidC would help determine the relative importance of each pathway for YiaD localization.

When designing experiments to study this question, researchers should employ:

  • Site-directed mutagenesis of the YiaD signal sequence

  • Fluorescent tagging systems for localization studies

  • Co-immunoprecipitation to identify interaction partners

  • Protease accessibility assays to determine topology

What are the structural determinants of YiaD's membrane association and orientation?

Understanding YiaD's membrane topology requires a multi-faceted approach:

Experimental ApproachMethodologyExpected Outcome
Cysteine accessibility studiesCreate single-cysteine variants throughout YiaD sequence and test accessibility to membrane-impermeable reagentsMaps regions exposed to periplasm vs. cytoplasm
Proteinase K digestion assaysTreat spheroplasts and inverted membrane vesicles with proteinase KIdentifies protected domains
GFP-fusion analysisCreate fusions with GFP at different positionsFluorescence indicates cytoplasmic exposure
Cryo-EM or X-ray crystallographyPurify and crystallize the proteinDetailed structural information

When investigating membrane proteins like YiaD, harmonizing production rates with the capacity of the secretory apparatus is crucial for obtaining properly folded protein for structural studies . Using optimized translational initiation regions (TIRs) can help achieve the right balance between expression and proper membrane insertion.

How does YiaD function differ from other E. coli inner membrane lipoproteins?

To distinguish YiaD's functional role from other inner membrane lipoproteins:

  • Conduct comparative phenotypic analyses of ΔyiaD mutants versus mutants of other lipoproteins under various stress conditions (osmotic, oxidative, temperature, antibiotic exposure)

  • Perform transcriptome analysis (RNA-seq) of ΔyiaD strains to identify compensatory expression changes

  • Use protein-protein interaction studies (bacterial two-hybrid or pull-down assays) to map interaction networks

  • Employ lipidomic analysis to determine if YiaD affects membrane lipid composition

This comparative approach would follow similar methodological principles used to differentiate the functions of YidC and YidD in membrane protein insertion , where targeted gene deletions and complementation studies revealed specific phenotypic effects.

What purification strategy yields the highest purity and activity of recombinant YiaD?

A systematic approach to purifying recombinant YiaD would include:

Purification StepRecommended MethodConsiderations
Cell lysisGentle methods (e.g., osmotic shock or enzymatic lysis)Preserves membrane structures
Membrane fraction isolationDifferential ultracentrifugationSeparates inner and outer membranes
Detergent extractionTest panel of mild detergents (DDM, LMNG, LDAO)Optimize solubilization efficiency
Affinity chromatographyIMAC using His-tag or other fusion tagsInitial capture step
Size exclusion chromatographySuperdex 200Removes aggregates and impurities
Quality assessmentSDS-PAGE, Western blot, mass spectrometryConfirms identity and purity

For optimal results, consider a signal peptide and production rate-based combinatorial screening approach as described for other periplasmic proteins . This involves testing different signal peptides (DsbA, OmpA, PhoA, Hbp) in combination with varying expression rates to identify conditions yielding the highest amount of properly folded protein.

What are the optimal conditions for assessing YiaD's membrane association and lipid modification?

To effectively study YiaD's membrane properties:

  • Utilize a membrane fractionation protocol that clearly distinguishes between inner and outer membrane fractions using sucrose density gradient centrifugation

  • Confirm lipid modification through mass spectrometry analysis:

    • Perform tryptic digestion of purified YiaD

    • Analyze N-terminal peptides for lipid modifications

    • Compare theoretical and observed masses

  • Assess membrane association strength through:

    • Carbonate extraction (pH 11.5) to distinguish peripheral vs. integral association

    • Sequential detergent extraction with increasingly harsh detergents

    • Thermal stability assays with a membrane mimetic environment

When analyzing lipoproteins like YiaD, it's essential to avoid protein aggregation during purification, as this can significantly impact functional analyses. Using appropriate detergent:protein ratios and including stabilizing agents (glycerol, specific lipids) can help maintain the native state.

How can crosslinking studies reveal YiaD's interaction partners in the membrane?

Crosslinking methodology for studying YiaD interactions:

  • In vivo photo-crosslinking:

    • Incorporate photo-activatable amino acids (pBpa or Azi) at strategic positions within YiaD

    • UV-activate crosslinking in living cells

    • Identify crosslinked partners via mass spectrometry

  • In vitro chemical crosslinking:

    • Use homo- or hetero-bifunctional crosslinkers with varying spacer lengths

    • Target specific amino acid residues (e.g., DSS for lysines, EDC for carboxyl-amine crosslinking)

    • Optimize crosslinker concentration and reaction time

  • Proximity-dependent biotin identification (BioID):

    • Fuse YiaD to a biotin ligase (BirA*)

    • Express in E. coli and supplement with biotin

    • Identify biotinylated proteins as proximal interactors

This approach parallels methods used to demonstrate that YidD is in proximity to nascent inner membrane proteins during their insertion into the Sec-YidC translocon , providing insights into potential functional interactions.

How should contradictory data about YiaD's localization be reconciled?

When faced with conflicting data about YiaD localization:

  • Systematically evaluate methodological differences between studies:

    • Strain backgrounds used (K-12 vs. B strains, specific mutations)

    • Growth conditions (media, temperature, growth phase)

    • Detection methods (antibody specificity, tagging interference)

  • Perform complementary localization approaches:

    • Biochemical fractionation followed by immunoblotting

    • Fluorescence microscopy with minimally disruptive tags

    • Enzyme accessibility assays (PhoA, LacZ fusion strategies)

    • Protease shaving coupled with mass spectrometry

  • Consider dynamic localization:

    • Test localization under different stress conditions

    • Examine temporal changes during cell cycle progression

When analyzing membrane protein localization data, it's critical to consider how experimental conditions might affect membrane organization. For instance, expression levels that saturate the secretory apparatus can lead to mislocalization artifacts .

What control experiments are essential when studying YiaD's contribution to membrane integrity?

To rigorously assess YiaD's role in membrane integrity:

Control TypeExperimental ApproachPurpose
Genetic controlsComplementation with wild-type YiaDConfirms phenotype is due to YiaD loss
Complementation with site-directed mutantsIdentifies critical residues
Empty vector controlControls for plasmid effects
Phenotypic controlsKnown membrane integrity mutants (e.g., ΔlptD, ΔtolA)Provides comparison to established phenotypes
Wild-type under membrane stress (polymyxin, EDTA)Positive control for assays
Analytical controlsInner membrane markers (e.g., LacY, SecY)Validates fractionation procedures
Periplasmic markers (e.g., MalE)Controls for selective permeabilization
Cytoplasmic markers (e.g., GroEL)Controls for lysis or contamination

Include measurements of membrane potential, permeability to hydrophobic compounds, and sensitivity to detergents to comprehensively assess membrane integrity. Similar control strategies have been crucial in defining the roles of other membrane-associated proteins like YidD .

How can heterogeneity in YiaD expression be addressed in single-cell studies?

When conducting single-cell analyses of YiaD:

  • Implement strategies to minimize expression heterogeneity:

    • Use precise tunable promoter systems like the rhamnose-inducible promoter

    • Optimize the translational initiation region (TIR) to achieve consistent expression levels

    • Consider genomic integration rather than plasmid-based expression

  • Employ analytical approaches to account for heterogeneity:

    • Single-cell sorting based on expression levels

    • Microfluidic chambers for controlled growth environments

    • Time-lapse microscopy to track individual cell lineages

  • Quantitative analysis methods:

    • Automated image analysis with cell segmentation

    • Statistical approaches that account for population distributions

    • Machine learning algorithms to identify expression patterns

This approach aligns with strategies used in other periplasmic protein studies where translational optimization was found to be more effective than maximizing expression , thereby reducing the cell-to-cell variability that can complicate single-cell analyses.

What are the key considerations for designing a comprehensive study of YiaD function?

A robust investigation of YiaD should incorporate:

  • Multiple complementary approaches to determine localization and topology

  • Careful control of expression levels to avoid artifacts from overexpression

  • Phenotypic characterization under various stress conditions

  • Identification of interaction partners through unbiased screening methods

  • Comparative analysis with related lipoproteins to identify unique functions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.