Recombinant Escherichia coli Inner membrane protein CbrB (cbrB)

Shipped with Ice Packs
In Stock

Description

Introduction and Basic Characteristics

Recombinant E. coli inner membrane protein CbrB (cbrB) is a bioengineered version of the native cbrB gene product, expressed in E. coli for research applications. Classified as an inner membrane protein, it is also known as CreB-regulated gene B protein, suggesting potential regulation by the cAMP receptor protein (CreB/Crp) . The protein is part of the E. coli K12 strain proteome, with the Uniprot identifier P31468.

Key Features

  • Gene/Protein Names: cbrB, yieI (synonym) .

  • Expression Region: Full-length (1–155 amino acids) .

  • Tagging: N-terminal 10xHis-tag for purification .

  • Storage: Tris-based buffer with 50% glycerol, stored at -20°C or -80°C .

Production and Expression Systems

CbrB is heterologously expressed in E. coli using optimized recombinant techniques. While specific protocols for CbrB production are not detailed in the literature, general strategies for E. coli membrane protein expression include:

  • Host Strains: BL21(DE3) or derivatives like SuptoxR strains (e.g., SuptoxR2.1/2.2), which suppress toxicity and enhance yields .

  • Vectors: T7 RNA polymerase-driven systems (e.g., pET vectors) for inducible expression .

  • Cultivation: Growth at suboptimal temperatures (e.g., 18–25°C) to reduce aggregation .

Comparison of Expression Strategies

StrategyAdvantageApplication
SuptoxR strainsSuppresses cytotoxicity, enhances foldingHigh-yield production of eukaryotic MPs
T7 RNA polymerase systemsTight regulation, scalable productionStructural studies (e.g., X-ray crystallography)
Membrane-targeting chaperonesAssists folding (e.g., YidC, Skp)Mitigates misfolded protein stress

Challenges and Future Directions

  • Limited Functional Data: No peer-reviewed studies explicitly characterize CbrB’s role.

  • Production Optimization: Need for strain engineering (e.g., SuptoxR) to improve yield and folding .

  • Structural Elucidation: Use of cryo-EM or NMR to resolve membrane topology.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the product for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
cbrB; yieI; b3716; JW3694; Inner membrane protein CbrB; CreB-regulated gene B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
cbrB
Target Protein Sequence
MSVSRRVIHHGLYFAVLGPLIGVLFLVLYIFFAKEPLVLWVIIHPIFLLLSITTGAIPAL LTGVMVACLPEKIGSQKRYRCLAGGIGGVVITEIYCAVIVHIKGMASSELFENILSGDSL VVRIIPALLAGVVMSRIITRLPGLDISCPETDSLS
Uniprot No.

Target Background

Database Links
Protein Families
CbrB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Escherichia coli Inner membrane protein CbrB?

Escherichia coli Inner membrane protein CbrB is a bacterial protein localized to the inner membrane of E. coli. It belongs to the CbrB protein family found in various E. coli strains, including pathogenic variants like O1:K1/APEC. The protein structure typically consists of 157 amino acids and plays specific roles in bacterial cellular processes. When expressing this protein recombinantly, researchers typically use bacterial expression systems such as E. coli itself, although yeast, baculovirus, or mammalian cell expression systems may also be employed depending on experimental requirements .

What expression systems are suitable for recombinant CbrB production?

Several expression systems can be utilized for recombinant CbrB production, with E. coli being the most common due to its rapid growth rate, high cell density capabilities, well-established genetic background, and economic viability. Alternative expression systems include yeast, baculovirus, and mammalian cells, each offering distinct advantages depending on research objectives . The choice of expression system should be guided by considerations such as required post-translational modifications, protein solubility needs, and downstream application requirements. For most basic research applications, E. coli-based expression remains the preferred method due to its simplicity and high protein yields when optimized correctly .

What are the typical applications of recombinant CbrB protein in research?

Recombinant CbrB protein has several research applications, particularly in understanding bacterial membrane biology and protein function. Common applications include:

  • Structural studies to determine protein conformation and functional domains

  • Protein-protein interaction studies to identify binding partners

  • Antibody production for detection and localization experiments

  • Functional assays to determine biochemical activities

  • Vaccine development research as a potential bacterial antigen

The purified protein can serve as a tool for investigating bacterial membrane protein dynamics and may contribute to broader understanding of bacterial physiology and pathogenesis .

How do I determine the purity and identity of recombinant CbrB protein?

Determining purity and identity of recombinant CbrB involves multiple complementary analytical techniques:

  • SDS-PAGE analysis to assess protein size and purity (expect a band corresponding to approximately 157 amino acids)

  • Western blotting using anti-CbrB or anti-tag antibodies for identity confirmation

  • Mass spectrometry for precise molecular weight determination and peptide mapping

  • Circular dichroism to evaluate secondary structure integrity

  • Size exclusion chromatography to assess oligomeric state and homogeneity

For identity confirmation, comparing peptide mass fingerprinting data with predicted sequences from databases provides definitive validation. Protein purity of at least 75% is typically achievable using optimized purification protocols, as demonstrated in similar recombinant protein expression studies .

What strategies can optimize soluble expression of recombinant CbrB protein?

Optimizing soluble expression of recombinant CbrB requires a multivariate approach addressing several critical parameters:

  • Expression strain selection: BL21(DE3), Rosetta, or C41/C43 strains specialized for membrane proteins

  • Growth temperature modulation: Lowering to 16-25°C post-induction often enhances solubility

  • Induction parameters: Optimizing IPTG concentration (typically 0.1-0.5 mM) and induction timing

  • Media composition: Enriched media with osmolytes or specific additives can improve folding

  • Co-expression with chaperones: GroEL/GroES or trigger factor can facilitate proper folding

  • Fusion tags: MBP, SUMO, or thioredoxin fusion can enhance solubility

Experimental design methodologies employing fractional factorial screening have demonstrated success in achieving high levels (up to 250 mg/L) of soluble expression for similar recombinant proteins in E. coli systems . The multivariant analysis approach is particularly valuable as it enables assessment of variable interactions that might not be apparent using traditional one-variable-at-a-time optimization methods.

How do membrane proteins like CbrB differ in expression challenges compared to cytosolic proteins?

Membrane proteins like CbrB present distinct expression challenges compared to cytosolic proteins:

ParameterMembrane Proteins (CbrB)Cytosolic Proteins
ToxicityOften higherGenerally lower
Folding requirementsComplex, requiring membrane integrationSimpler folding pathways
Expression levelsTypically lower (mg/L range)Often higher (g/L possible)
SolubilityRequires detergents/membrane mimeticsWater-soluble
Host strain requirementsSpecialized (C41/C43, membrane protein-optimized)Standard expression strains
Purification complexityMultiple detergent exchange stepsSimpler protocols

For CbrB specifically, the hydrophobic transmembrane domains necessitate specialized expression and purification strategies. Experimental design approaches using multivariant analysis can help identify optimal conditions, as membrane protein expression is significantly affected by the interplay between induction conditions, growth parameters, and media composition .

What are the critical factors affecting functional activity of recombinant CbrB?

The functional activity of recombinant CbrB is influenced by several critical factors that must be carefully controlled:

  • Proper membrane integration: Native-like membrane insertion is essential for function

  • Post-translational modifications: Any required modifications must be preserved

  • Protein conformation: The three-dimensional structure must maintain functional domains

  • Lipid environment: Specific lipid interactions may be required for activity

  • Buffer composition: pH, ionic strength, and specific ions can affect activity

  • Storage conditions: Stability during storage affects long-term activity retention

Experimental evidence indicates that induction conditions significantly impact functional activity, with shorter induction times (4-6 hours) often producing higher specific activity than extended expressions . Activity assays should be established to measure functionality, as high protein yield does not always correlate with high functional activity.

How can I design experiments to evaluate the impact of expression conditions on CbrB yield and solubility?

Designing experiments to evaluate expression conditions for CbrB should utilize statistical design of experiments (DoE) approaches:

  • Identify key variables: Temperature, inducer concentration, media composition, induction time, etc.

  • Apply fractional factorial design: Test multiple variables simultaneously while minimizing experiment numbers

  • Include center points: To detect non-linear effects and estimate experimental error

  • Analyze responses: Measure protein yield, solubility percentage, and functional activity

  • Build predictive models: Use response surface methodology to identify optimal conditions

  • Validation experiments: Confirm predicted optimal conditions experimentally

This approach has been successfully applied to recombinant protein expression, yielding up to 250 mg/L of soluble, functional protein with approximately 75% homogeneity . The statistical analysis enables identification of not only individual variable effects but also important interactions between variables that affect expression outcomes.

What statistical approaches are recommended for optimizing multiple variables in CbrB expression?

For optimizing CbrB expression, statistical experimental design methodologies offer significant advantages over traditional one-variable-at-a-time approaches:

  • Fractional factorial design: Enables testing of 8+ variables with a reduced number of experiments while maintaining statistical validity

  • Plackett-Burman design: Efficiently screens many variables to identify the most significant factors

  • Central composite design: Allows modeling of response surfaces for optimal condition identification

  • Box-Behnken design: Provides response surface information with fewer experiments than full factorial

  • Definitive screening design: Differentiates between main effects and quadratic effects efficiently

How should induction conditions be optimized for maximum soluble CbrB expression?

Optimizing induction conditions for CbrB requires systematic evaluation of multiple parameters:

  • Induction timing: Typically at mid-log phase (OD600 0.6-0.8) but may vary based on promoter system

  • Inducer concentration: For IPTG, test range from 0.1-1.0 mM

  • Temperature shift: Often reducing from 37°C to 16-25°C upon induction

  • Induction duration: 4-6 hours often provides optimal balance between yield and activity

  • Cell density at induction: Can significantly impact protein folding and yield

  • Media composition during induction: Addition of osmolytes or specific additives

Research has demonstrated that induction times between 4-6 hours often yield similar productivity levels, while longer induction periods (>6 hours) can reduce productivity for membrane proteins like CbrB . A structured experimental design approach enables identification of interactions between these variables that significantly impact expression outcomes.

What experimental controls should be included when optimizing recombinant CbrB expression?

Proper experimental controls are essential for reliable optimization of CbrB expression:

  • Negative expression control: Uninduced culture carrying the expression vector

  • Empty vector control: Cells with vector lacking the CbrB gene, subjected to induction

  • Positive expression control: Well-characterized protein expressed under standard conditions

  • Technical replicates: Multiple samples from the same culture condition

  • Biological replicates: Independent cultures of the same condition

  • Center point replicates: In DoE studies, to estimate experimental error and detect non-linearity

For statistical validation, at least three biological replicates should be performed for each condition, with center points included in factorial designs to assess reproducibility and experimental error . These controls enable accurate interpretation of the effects of experimental variables on expression outcomes.

How can I develop a scalable process for CbrB expression from benchtop to larger volumes?

Developing a scalable process for CbrB expression requires systematic evaluation of scale-dependent parameters:

  • Parameter identification: Determine critical process parameters (CPPs) during small-scale optimization

  • Scale-up considerations:

    • Oxygen transfer rate (OTR)

    • Heat transfer capabilities

    • Mixing efficiency

    • pH control precision

    • Nutrient availability

  • Scale-up approach options:

    • Constant power per volume (P/V)

    • Constant oxygen transfer coefficient (kLa)

    • Constant impeller tip speed

    • Geometric similarity

The experimental design methodology utilized at bench scale (typically 0.5-2L) provides a foundation for identifying process parameters that can be maintained or adjusted during scale-up . Monitoring cell growth, protein expression levels, and solubility at each scale is essential to ensure consistent product quality attributes throughout the scaling process.

How can I address low yield issues in recombinant CbrB expression?

Low yield issues in CbrB expression can be systematically addressed through several strategies:

  • Plasmid stability assessment: Verify plasmid maintenance throughout the culture period

  • Codon optimization: Analyze rare codon usage and consider optimized gene synthesis

  • Promoter strength evaluation: Consider alternative promoters if toxicity is observed

  • Expression strain screening: Test multiple E. coli strains optimized for membrane proteins

  • Cell growth conditions: Ensure optimal media formulation and growth parameters

  • Induction protocol refinement: Adjust timing, temperature, and inducer concentration

  • Harvest timing optimization: Determine optimal expression window before potential degradation

For membrane proteins like CbrB, specialized E. coli strains such as C41/C43 or Lemo21(DE3) often provide improved expression compared to standard BL21(DE3) . The multivariant experimental design approach can efficiently identify combinations of conditions that overcome yield limitations.

What approaches can resolve protein aggregation and inclusion body formation with CbrB?

Resolving protein aggregation and inclusion body formation for CbrB requires multiple complementary approaches:

  • Temperature reduction: Lowering post-induction temperature to 16-25°C

  • Inducer concentration optimization: Reducing IPTG levels to 0.1-0.5 mM

  • Co-expression strategies:

    • Molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Folding modulators (trigger factor, Skp)

  • Fusion partners: MBP, SUMO, or thioredoxin tags can enhance solubility

  • Media supplementation:

    • Osmolytes (glycerol, sorbitol)

    • Chemical chaperones (betaine, TMAO)

  • Expression rate moderation: Using weaker promoters or lower copy number plasmids

Statistical experimental design approaches have demonstrated that the interaction between temperature, induction time, and media composition significantly impacts soluble expression of membrane proteins like CbrB . Optimization can achieve up to 75% soluble expression versus inclusion body formation under optimal conditions.

How can I troubleshoot protein degradation during CbrB expression or purification?

Addressing protein degradation during CbrB expression or purification requires a systematic approach:

  • Protease inhibition strategies:

    • Use of protease-deficient strains (BL21, Rosetta)

    • Addition of protease inhibitor cocktails

    • EDTA addition (for metalloprotease inhibition)

  • Expression condition optimization:

    • Reduced induction time (4-6 hours optimal)

    • Lower temperature to reduce protease activity

  • Harvest and lysis optimization:

    • Rapid processing post-harvest

    • Cold temperature maintenance

    • Gentle lysis methods for membrane proteins

  • Purification considerations:

    • Avoid freeze-thaw cycles

    • Include stabilizing agents (glycerol, specific detergents)

    • Optimize buffer conditions (pH, salt concentration)

Research indicates that shorter induction times (4-6 hours) often result in higher quality product with less degradation compared to extended expression periods . Time-course experiments with Western blot analysis can identify the optimal harvest point before significant degradation occurs.

What strategies help overcome toxicity issues when expressing CbrB in E. coli?

Overcoming toxicity issues during CbrB expression requires several targeted approaches:

  • Expression control strategies:

    • Tightly regulated promoters (araBAD, rhamnose)

    • Lower copy number plasmids

    • Glucose repression for leaky promoters

  • Host strain selection:

    • C41/C43 strains (derived from BL21 by selection for toxic protein tolerance)

    • Lemo21(DE3) with tunable expression

  • Growth optimization:

    • Rich media to support stressed cells

    • Lower culture temperatures (30°C pre-induction)

  • Induction modifications:

    • Reduced inducer concentration

    • Later induction at higher cell densities

    • Shorter expression periods

For membrane proteins like CbrB that may disrupt host membrane integrity, specialized E. coli strains such as C41/C43 have been demonstrated to provide significantly improved tolerance to membrane protein overexpression . The combination of strain selection with controlled expression parameters can overcome toxicity while maintaining adequate protein yields.

How should I analyze and interpret experimental design data for CbrB expression optimization?

Analyzing experimental design data for CbrB expression optimization requires systematic statistical approaches:

  • Initial data evaluation:

    • Check for outliers and experimental errors

    • Verify normal distribution of residuals

  • Effect estimation:

    • Calculate main effects of each variable

    • Determine interaction effects between variables

  • Statistical significance assessment:

    • ANOVA analysis for each factor and interaction

    • Pareto charts to visualize significant effects

  • Model building:

    • Regression analysis to build predictive equations

    • Response surface methodology for optimization

  • Validation experiments:

    • Confirm model predictions with targeted experiments

    • Refine models as needed

Analysis typically reveals that certain combinations of variables (such as temperature and induction time, or media composition and inducer concentration) have significant interactive effects that would not be discovered through one-factor-at-a-time approaches . Software packages like Design-Expert, JMP, or R with appropriate statistical packages facilitate this complex data analysis.

What bioinformatic approaches can predict membrane topology and functional domains of CbrB?

Bioinformatic prediction of CbrB membrane topology and functional domains utilizes several computational tools:

  • Transmembrane domain prediction:

    • TMHMM Server

    • Phobius

    • TOPCONS

    • MEMSAT-SVM

  • Functional domain identification:

    • InterProScan

    • Pfam database

    • SMART analysis

  • Structural homology modeling:

    • Swiss-Model

    • I-TASSER

    • AlphaFold2

  • Evolutionary analysis:

    • Multiple sequence alignment with CLUSTALW or MUSCLE

    • Conservation analysis to identify functional residues

For inner membrane proteins like CbrB, combining predictions from multiple algorithms provides more reliable topology models. These predictions guide experimental approaches, such as designing constructs with soluble domains or determining optimal detergent selection for purification based on hydrophobicity profiles.

How can I design experiments to investigate CbrB protein-protein interactions in the bacterial membrane?

Investigating CbrB protein-protein interactions requires specialized experimental approaches for membrane proteins:

  • Genetic interaction screens:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Synthetic genetic arrays to identify functional interactions

  • Biochemical approaches:

    • Co-immunoprecipitation with membrane-compatible detergents

    • Chemical crosslinking followed by mass spectrometry

    • Blue native PAGE for complex identification

  • Biophysical methods:

    • FRET or BRET assays with fluorescent protein fusions

    • Surface plasmon resonance with purified components

    • Microscale thermophoresis for interaction affinity measurement

  • Structural studies:

    • Cryo-EM of membrane protein complexes

    • X-ray crystallography of co-purified components

Experimental design for these studies should include appropriate negative controls (mutated binding interfaces) and positive controls (known interaction partners) to validate results. Sequential optimization of detergent conditions is often required to maintain native-like interactions while enabling experimental manipulation.

What techniques can assess the structural integrity and proper folding of recombinant CbrB?

Assessing structural integrity and proper folding of recombinant CbrB utilizes multiple complementary techniques:

  • Spectroscopic methods:

    • Circular dichroism (CD) for secondary structure assessment

    • Fluorescence spectroscopy for tertiary structure evaluation

    • FTIR for membrane protein structure analysis

  • Hydrodynamic techniques:

    • Size exclusion chromatography to assess oligomeric state

    • Analytical ultracentrifugation for homogeneity analysis

  • Thermal stability assessment:

    • Differential scanning calorimetry (DSC)

    • Thermal shift assays with environment-sensitive dyes

  • Functional assays:

    • Ligand binding studies

    • Activity assays related to known function

    • Reconstitution into proteoliposomes for functional testing

The combination of structural analysis with functional assays provides the most comprehensive assessment of proper folding. Research demonstrates that proteins expressed under optimized conditions using experimental design approaches often show improved structural integrity compared to those expressed under standard conditions .

What are the current limitations in recombinant CbrB research and potential solutions?

Current limitations in recombinant CbrB research include several challenges:

  • Expression yield variability: Statistical experimental design approaches can help identify optimal, reproducible conditions

  • Membrane protein solubility: Novel detergents and membrane mimetics continue to improve solubilization options

  • Structural characterization difficulties: Advances in cryo-EM and computational prediction methods offer new opportunities

  • Functional assay development: Continued research into CbrB's physiological role will inform more relevant assay development

  • Scale-up challenges: Systematic application of DoE principles from bench to pilot scale can overcome process inconsistencies

Integration of computational approaches with high-throughput experimental screening may accelerate optimization processes. Additionally, alternative expression systems beyond E. coli might provide advantages for specific applications requiring complex folding or post-translational modifications.

How can research findings on CbrB contribute to broader understanding of bacterial membrane proteins?

Research on CbrB can contribute to broader membrane protein understanding through:

  • Methodology development: Optimization strategies may apply to other challenging membrane proteins

  • Structural insights: Understanding CbrB folding and stability may reveal principles applicable to related proteins

  • Functional characterization: Determining CbrB's role may illuminate broader bacterial membrane biology

  • Biotechnological applications: Insights into efficient expression may enhance production of other membrane proteins

  • Antimicrobial discovery: Understanding essential membrane protein expression may enable new therapeutic approaches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.