Recombinant Escherichia coli Inner membrane protein yabI (yabI)

Shipped with Ice Packs
In Stock

Description

Introduction to YabI

YabI is a 254-amino-acid polytopic inner membrane protein encoded by the yabI gene in E. coli K-12. It belongs to the DedA family, which is widely conserved in bacteria but absent in eukaryotes . Members of this family, including YghB and YqjA, are critical for cell division, membrane lipid homeostasis, and proton motive force (PMF)-dependent processes .

Key Features

  • Topology: Predicted to span the inner membrane 4–6 times, with cytoplasmic N- and C-termini .

  • Conservation: Shares sequence homology (24–61%) with other DedA family members (e.g., YghB, YqjA) .

  • Genomic Context: Located in a conserved operon with yabJ, a putative transcriptional regulator .

Primer Sequences for Cloning (from homologous DedA proteins)

GeneForward Primer (5’→3’)Reverse Primer (5’→3’)Restriction Sites
yabIGCGCCATATGGGCACATTATGCAAGCATTGCTGGAACGCGCAAGCTTTCCTAAACCCCAACCACTTTACGCNdeI, HindIII

Table 1: Primers used for PCR amplification of DedA family genes, adapted from methodologies in .

Roles in Membrane Biology

  • Cell Division: Double mutants lacking yabI and paralogs (e.g., ΔyghB ΔyqjA) exhibit filamentation due to septation defects, suggesting redundant roles in division .

  • Lipid Composition: DedA proteins influence phospholipid asymmetry and transport. For example, YghB/YqjA maintain PMF-dependent amidase export .

  • Stress Response: DedA homologs interact with envelope stress pathways (e.g., σᴱ, Cpx) , though YabI’s direct involvement remains uncharacterized.

Recombinant Expression and Purification

While no explicit studies on recombinant YabI are cited, methodologies for homologous DedA proteins provide a framework:

  1. Cloning: yabI is amplified via PCR (Table 1) and cloned into vectors (e.g., pET23a) using NdeI/HindIII sites .

  2. Expression: Induced with IPTG in E. coli BL21(DE3), yielding insoluble protein requiring solubilization (e.g., Triton X-100) .

  3. Membrane Localization: Confirmed by cell fractionation and Western blot .

Interaction Network

STRING analysis predicts functional partners linked to envelope maintenance :

Interacting ProteinFunctionInteraction Score
YohDDedA family inner membrane protein0.967
YghBPMF-dependent drug efflux; lipid homeostasis0.954
YdjZTVP38/TMEM64 family membrane protein0.905
YqjARedundant partner of YghB in amidase export0.522

Table 2: Predicted functional partners of YabI based on genomic context and homology .

Research Significance and Gaps

  • Unresolved Questions:

    • Mechanistic basis of YabI’s role in PMF or lipid transport.

    • Structural details (e.g., resolved 3D conformation).

  • Potential Applications:

    • Antimicrobial targets due to conservation in pathogens.

    • Tools for studying membrane protein assembly.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yabI; b0065; JW5005; Inner membrane protein YabI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-254
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yabI
Target Protein Sequence
MQALLEHFITQSTVYSLMAVVLVAFLESLALVGLILPGTVLMAGLGALIGSGELSFWHAW LAGIIGCLMGDWISFWLGWRFKKPLHRWSFLKKNKALLDKTEHALHQHSMFTILVGRFVG PTRPLVPMVAGMLDLPVAKFITPNIIGCLLWPPFYFLPGILAGAAIDIPAGMQSGEFKWL LLATAVFLWVGGWLCWRLWRSGKATDRLSHYLSRGRLLWLTPLISAIGVVALVVLIRHPL MPVYIDILRKVVGV
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW5005

STRING: 316407.85674310

Protein Families
DedA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the DedA Family of Inner Membrane Proteins and How Does YabI Fit Within This Classification?

The DedA family represents a group of highly conserved inner membrane proteins found in most bacteria. YabI is classified as a DedA family inner membrane protein in Escherichia coli (strain K12), identifiable by gene names ECK0066 and JW5005 . This protein family is characterized by:

  • Multiple transmembrane domains

  • Conservation across bacterial species

  • Involvement in membrane integrity maintenance

  • Potential roles in proton-dependent transport mechanisms

YabI represents one of several DedA family proteins in E. coli, alongside other members including dedA, yohD, yqjA, and yghB . Each of these proteins appears to have specialized yet potentially overlapping functions in bacterial membrane maintenance.

What Expression Systems Are Most Effective for Producing Recombinant YabI Protein?

When expressing recombinant YabI protein, researchers typically employ several systems with varying advantages depending on research goals:

Expression SystemAdvantagesLimitationsTypical YieldRecommended For
Cell-Free ExpressionRapid production, Eliminates membrane insertion challenges, Higher purityHigher cost, Lower yield for membrane proteins≥85% purity by SDS-PAGEStructural studies, Antibody production
E. coliCost-effective, High yield potential, Native environmentPotential toxicity issues, Inclusion body formation≥85% purity by SDS-PAGEFunctional studies, Large-scale production
Yeast/BaculovirusPost-translational modifications, Better folding for complex proteinsLonger production time, Higher cost≥85% purity by SDS-PAGEStudies requiring eukaryotic modifications

The most consistent results for recombinant YabI production have been achieved using cell-free expression systems, which can reliably produce protein with greater than 85% purity as determined by SDS-PAGE . This approach circumvents many of the challenges associated with membrane protein expression in cellular systems.

What Are the Standard Purification Methods for Recombinant YabI Protein?

Purification of recombinant YabI requires specialized techniques due to its nature as a membrane protein:

  • Initial Extraction: Typically employing detergent solubilization (e.g., n-dodecyl β-D-maltoside or CHAPS) to extract the protein from membranes while maintaining native conformation

  • Chromatography Sequence:

    • Affinity chromatography (using histidine tags)

    • Ion exchange chromatography to remove contaminants

    • Size exclusion chromatography for final polishing

  • Quality Assessment:

    • SDS-PAGE for purity determination (target ≥85%)

    • Western blot with anti-YabI antibodies for identity confirmation

    • Functional assays to ensure biological activity

The purification protocol should be optimized to maintain the membrane protein in a properly folded state, typically requiring the presence of appropriate detergents throughout the purification process.

How Do YabI and Other DedA Family Proteins Contribute to Cell Envelope Integrity in E. coli?

DedA family proteins, including YabI, play critical roles in maintaining bacterial cell envelope integrity through multiple mechanisms:

Research on related DedA family proteins YghB and YqjA has shown that deletion of both proteins results in severe cell envelope defects . These proteins are implicated in:

  • Membrane Homeostasis: Contributing to proper lipid composition and distribution

  • Protein Translocation: Supporting proper export of certain periplasmic proteins

  • PMF-Dependent Functions: May function as membrane transporters required for proton motive force (PMF)-dependent processes

  • Stress Response: Activation of envelope stress response systems when these proteins are absent

Specifically, studies of YqjA and YghB have identified conserved membrane-embedded arginine residues (R130 and R136) that are critical for function, supporting the hypothesis that these proteins function as membrane transporters . While YabI has not been as extensively characterized as YqjA and YghB, its classification within the same family suggests similar functional roles in maintaining membrane integrity.

Complementation studies with YabI in strains lacking other DedA family proteins could reveal the extent of functional overlap and specialization within this protein family.

What Experimental Design Considerations Are Critical When Studying YabI Function in Bacterial Membranes?

Designing robust experiments to investigate YabI function requires careful consideration of several factors:

  • Variable Definition and Control

    • Independent Variable: Typically the presence/absence or expression level of YabI

    • Dependent Variables: Membrane integrity markers, protein localization, stress response indicators

    • Control Variables: Growth conditions, bacterial strain background, expression of other membrane proteins

    • Confounding Variables: Expression of other DedA family proteins that may compensate for YabI function

  • Experimental Approaches Matrix:

Research QuestionRecommended ApproachKey ControlsData Analysis Method
Subcellular LocalizationFluorescent protein fusion + microscopyWild-type vs. tagged protein functional comparisonQuantitative image analysis
Membrane IntegrityEnvelope stress response reporter assaysΔyabI vs. wild-type comparisonsComparative statistical analysis
Protein InteractionsCo-immunoprecipitation, bacterial two-hybridNegative interaction controlsNetwork analysis
Functional RedundancyMultiple gene knockout combinationsSingle vs. double knockout phenotypesEpistasis analysis
  • Addressing Potential Contradictions:
    When studying complex membrane systems, contradictory data frequently emerge. Implementation of a structured contradiction analysis approach using parameters (α, β, θ) can help resolve these issues :

    • α: Number of interdependent items (e.g., proteins being studied)

    • β: Number of contradictory dependencies defined by domain experts

    • θ: Minimal number of required Boolean rules to assess these contradictions

This framework allows systematic evaluation of complex interdependencies within research data and helps identify the minimum number of experimental validations needed to resolve apparent contradictions .

How Can Advanced Proteomics Approaches Be Applied to Study YabI Interactions with Other Membrane Components?

Studying YabI's interactions with other membrane components requires specialized proteomics approaches:

  • Proximity-Based Labeling Techniques:

    • BioID or TurboID fusion proteins to identify proximal interacting partners

    • APEX2-based proximity labeling for temporal interaction mapping

    • Implementation protocol:

      1. Generate YabI-BioID fusion construct

      2. Express in E. coli under native promoter

      3. Provide biotin pulse for proximity labeling

      4. Lyse cells and perform streptavidin pulldown

      5. Identify labeled proteins by mass spectrometry

  • Crosslinking Mass Spectrometry (XL-MS):

    • In vivo chemical crosslinking to capture transient interactions

    • MS/MS analysis to identify crosslinked peptides

    • Computational modeling to reconstruct interaction interfaces

  • Data Integration Framework:
    Results from these approaches should be systematically integrated to create interaction networks, with special attention to:

    • Distinguishing direct vs. indirect interactions

    • Identifying condition-specific interactions

    • Correlating protein interactions with phenotypic outcomes

These advanced proteomics approaches, when combined with genetic approaches like synthetic genetic arrays, provide a comprehensive understanding of YabI's functional interactions in the bacterial membrane context.

How Can Contradictions in Research Data About YabI Be Systematically Analyzed and Resolved?

Contradictory findings regarding YabI function can be addressed using structured analytical approaches:

  • Contradiction Pattern Identification:
    Following the (α, β, θ) notation system , where:

    • α represents the number of interdependent items (e.g., different experimental conditions)

    • β represents the number of contradictory dependencies defined by domain experts

    • θ represents the minimal number of required Boolean rules to assess these contradictions

  • Implementation of a Structured Evaluation Framework:

    • Document all experimental conditions where contradictions occur

    • Identify potential confounding variables (strain differences, growth conditions, etc.)

    • Apply Boolean minimization techniques to reduce the complexity of contradictions

    • Design targeted experiments to specifically address the minimal set of rules (θ)

  • Knowledge Graph Analysis:
    Research on inconsistent knowledge graphs has shown that contradictions can be systematically analyzed using anti-pattern detection :

    • Kite graphs, cycle graphs, and domain/range-based graphs represent different patterns of contradiction

    • These patterns can be detected using specialized algorithms

    • Once identified, contradictions can be traced to their source and resolved

This approach transforms seemingly incompatible research findings into structured problems that can be systematically addressed through targeted experimentation.

What Synthetic Biology Approaches Can Be Used to Engineer YabI Variants with Enhanced Functions?

Engineering YabI variants with enhanced or modified functions can be approached through several synthetic biology strategies:

  • Structure-Guided Mutagenesis:

    • Target conserved residues identified in other DedA family proteins (analogous to R130 and R136 in YqjA/YghB )

    • Focus on charged residues within transmembrane domains that may be involved in ion transport

    • Implement alanine-scanning mutagenesis followed by functional assays

  • Domain Swapping with Other DedA Family Members:

    • Create chimeric proteins between YabI and other family members (YqjA, YghB, etc.)

    • Test for complementation of specific phenotypes

    • Map functional domains through systematic domain exchange

  • Directed Evolution Strategy:

    • Design selection system based on cell envelope stress response

    • Create random mutagenesis library of YabI variants

    • Select for variants that provide enhanced envelope integrity or stress resistance

    • Sequence and characterize beneficial mutations

  • Experimental Validation Workflow:

Engineering ApproachPrimary Screening MethodSecondary ValidationExpected Outcome
Targeted MutagenesisGrowth assays under stressMembrane integrity assaysIdentification of key functional residues
Domain SwappingComplementation of knockout phenotypesProtein localization studiesMapping of functional domains
Directed EvolutionSelection under stress conditionsWhole genome sequencingNovel variants with enhanced function

These approaches, particularly when combined with structural biology techniques, can provide both fundamental insights into YabI function and potentially engineered variants with applications in synthetic biology and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.