Recombinant Escherichia coli Inner membrane protein yagU (yagU)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specific tag if one is requested.
Synonyms
yagU; b0287; JW0281; Inner membrane protein YagU
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yagU
Target Protein Sequence
MNIFEQTPPNRRRYGLAAFIGLIAGVVSAFVKWGAEVPLPPRSPVDMFNAACGPESLIRA AGQIDCSRNFLNPPYIFLRDWLGLTDPNAAVYTFAGHVFNWVGVTHIIFSIVFAVGYCVV AEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPPLFDLPWYENVSEIFGHLVWFWSIE IIRRDLRNRITHEPDPEIPLGSNR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YagU and what is its known function in E. coli?

YagU is an integral inner membrane protein in Escherichia coli whose precise physiological function remains incompletely characterized. Similar to other inner membrane proteins such as YqjD, YagU is embedded in the cytoplasmic membrane with transmembrane domains spanning the phospholipid bilayer . While the specific function of YagU is still being investigated, it likely plays a role in membrane integrity, cellular homeostasis, or stress response pathways, comparable to other inner membrane proteins in E. coli. The protein's physiological significance may be context-dependent, potentially becoming more important under specific growth conditions or stress situations.

How are inner membrane proteins like YagU structurally different from outer membrane proteins in E. coli?

Inner membrane proteins like YagU fundamentally differ from outer membrane proteins (OMPs) in their structural organization. Inner membrane proteins typically contain α-helical transmembrane domains that span the phospholipid bilayer, while outer membrane proteins form β-barrel structures . This structural distinction reflects their different environments: the inner membrane is a phospholipid bilayer, whereas the outer membrane contains lipopolysaccharides in its outer leaflet. Additionally, inner membrane proteins often have hydrophilic domains exposed to either the cytoplasm or periplasm, whereas outer membrane proteins have loops exposed to the extracellular environment . Unlike OMPs such as OmpA, OmpC, OmpF and LamB that can be readily identified by SDS-PAGE due to their abundance, inner membrane proteins like YagU are generally less abundant and may require specific detection methods.

What expression systems are recommended for recombinant YagU production?

For effective recombinant production of YagU, E. coli BL21(DE3) derivative strains are typically recommended as expression hosts . These strains provide the machinery necessary for high-level protein expression while lacking certain proteases that could degrade the recombinant protein. For controlled expression, plasmid systems containing inducible promoters such as T7 (IPTG-inducible) or tet (anhydrotetracycline-inducible) promoters have proven effective for membrane proteins . When working with challenging membrane proteins like YagU, modified expression hosts such as C41(DE3) or C43(DE3), specifically engineered for membrane protein expression, may provide better results. Expression conditions should be optimized with lower temperatures (typically 16-30°C rather than 37°C) and moderate inducer concentrations to prevent protein aggregation and support proper membrane insertion.

What are the most effective methods for isolating and purifying recombinant YagU?

Purification of YagU should follow established protocols for inner membrane proteins, beginning with proper cell lysis and membrane fractionation. The following methodological approach is recommended:

  • Cell disruption: Use mechanical methods (sonication, French press, or homogenization) in buffer containing protease inhibitors to preserve protein integrity.

  • Membrane fractionation: Employ differential centrifugation to separate inner and outer membranes. First remove unbroken cells and debris (4,000-5,000 rpm, 5-10 minutes), then isolate total membranes by ultracentrifugation (50,000 rpm, 1-1.5 hours) . Inner membranes can be further separated from outer membranes using sucrose density gradient centrifugation.

  • Solubilization: Extract YagU from membranes using mild detergents such as n-dodecyl-β-D-maltoside (DDM), LDAO, or Triton X-100 at concentrations slightly above their critical micelle concentration.

  • Affinity purification: If YagU is tagged (with His6, StrepII, or other affinity tags), use appropriate affinity chromatography. For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is standard.

  • Further purification: Apply size exclusion chromatography to obtain highly pure protein and ensure proper oligomeric state.

For quality assessment, use SDS-PAGE analysis combined with Western blotting using tag-specific or YagU-specific antibodies .

How can researchers optimize expression conditions for maximum YagU yield?

Optimizing YagU expression requires systematic testing of multiple parameters:

Expression strain selection:

  • Consider using specialized E. coli strains like the knockout strains described by Meuskens et al., which have improved expression for membrane proteins through deletion of abundant outer membrane proteins (OmpA, OmpC, OmpF, and LamB) .

  • For inner membrane proteins like YagU, strains such as C41(DE3), C43(DE3), or Lemo21(DE3) may offer advantages.

Expression vector considerations:

  • Include a strong but controllable promoter (T7, tac, or tet).

  • Incorporate an appropriate signal sequence to direct the protein to the inner membrane.

  • Add an affinity tag (preferably at the C-terminus) for detection and purification.

Optimization parameters table:

ParameterRange to TestNotes
Temperature16°C, 25°C, 30°CLower temperatures often improve folding
Inducer concentrationIPTG: 0.1-1.0 mM or aTc: 10-200 ng/mlStart with lower concentrations
Cell density at inductionOD600: 0.4-0.8Mid-log phase typically optimal
Post-induction time2-24 hoursLonger at lower temperatures
Media compositionLB, TB, 2xYT, M9Rich media may improve yields
AdditivesGlycerol (5%), glucose (0.5-1%)Can stabilize membrane proteins

Monitor expression using Western blotting and activity assays rather than relying solely on SDS-PAGE, as inner membrane proteins may not be clearly visible on stained gels due to their hydrophobicity and sometimes lower expression levels .

What detection methods are most suitable for confirming successful YagU expression?

Multiple complementary detection approaches should be employed:

  • Western blotting: The most reliable method for specific detection of YagU. Use antibodies against YagU directly or against affinity tags (His-tag, HA-tag, or StrepII-tag) incorporated into the recombinant construct . Western blotting can detect even low expression levels and confirm the expected molecular weight.

  • Subcellular fractionation: Perform membrane fractionation followed by SDS-PAGE and Western blotting to confirm localization to the inner membrane fraction, similar to the approach used for YqjD .

  • Fluorescence microscopy: For in vivo localization studies, GFP fusion constructs can verify proper membrane insertion and distribution.

  • Mass spectrometry: For unambiguous identification and characterization of purified YagU, particularly useful when antibodies are unavailable.

  • Whole-cell ELISA: If YagU contains extracellular domains with accessible epitopes, whole-cell ELISA can quantitatively assess expression levels between different strains or conditions .

For proteins like YagU that may not always be easily visualized by standard Coomassie staining, consider using more sensitive staining methods such as silver staining or SYPRO Ruby for SDS-PAGE gels.

How does YagU compare structurally and functionally with the better-characterized YqjD protein?

While YagU and YqjD are both inner membrane proteins in E. coli, they exhibit distinct characteristics:

Structural comparison:

  • Both YagU and YqjD possess transmembrane domains in their C-terminal regions. YqjD's transmembrane motif spans residues 77-98 .

  • YqjD has a molecular weight of approximately 11 kDa (specifically 11,052 Da) with a pI of 9.1, which may differ from YagU's physicochemical properties .

  • YqjD contains domains for both membrane association and ribosome binding, particularly at its N-terminal region .

Functional comparison:

  • YqjD is expressed during stationary phase under regulation of the stress response sigma factor RpoS, potentially indicating a stress-response role .

  • YqjD binds to 70S and 100S ribosomes via its N-terminal region, suggesting involvement in translation regulation during stationary phase .

  • YqjD overexpression inhibits cell growth, implying it may be involved in growth regulation mechanisms .

  • YqjD may function to localize ribosomes to the inner membrane during stationary phase .

While specific comparative data for YagU is limited in the provided literature, researchers interested in YagU should consider investigating whether it shares any of these functional characteristics with YqjD, particularly regarding growth phase-dependent expression, potential interactions with cellular machinery, and effects of overexpression on cellular physiology.

What advanced biophysical techniques are most informative for characterizing YagU structure and interactions?

For comprehensive structural and functional characterization of YagU, the following advanced techniques are recommended:

  • Cryo-electron microscopy (cryo-EM): Particularly valuable for membrane proteins that resist crystallization, cryo-EM can provide near-atomic resolution structures of YagU in a near-native lipid environment.

  • X-ray crystallography: Though challenging for membrane proteins, this technique can provide atomic-level structural details if high-quality YagU crystals can be obtained, typically requiring extensive detergent screening and crystallization condition optimization.

  • Nuclear Magnetic Resonance (NMR) spectroscopy: Solution or solid-state NMR can provide structural information and dynamics data for YagU. This requires isotope labeling (15N, 13C) of the recombinant protein, achievable by expression in minimal media with labeled nitrogen and carbon sources.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This technique can identify solvent-exposed regions of YagU and map conformational changes upon ligand binding or during protein-protein interactions.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): These methods can quantitatively measure binding affinities between YagU and potential interaction partners or ligands.

  • Fluorescence resonance energy transfer (FRET): When combined with site-specific fluorescent labeling, FRET can measure distances between specific regions of YagU and provide information about conformational changes.

  • Atomic force microscopy (AFM): This technique can visualize YagU in membrane environments and measure mechanical properties at the single-molecule level.

For functional studies, combining these structural approaches with site-directed mutagenesis of key residues and subsequent activity assays would provide the most comprehensive understanding of YagU's structure-function relationships.

How can researchers effectively study YagU's potential interactions with other cellular components?

Investigating YagU's protein-protein interactions and its role in cellular processes requires multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against YagU or its affinity tag to pull down protein complexes, followed by mass spectrometry to identify interaction partners. This approach was valuable in identifying YqjD's interaction with ribosomes .

  • Bacterial two-hybrid systems: These genetic screens can identify potential interaction partners in vivo, though care must be taken with membrane proteins to ensure proper expression and localization.

  • Chemical crosslinking combined with mass spectrometry (XL-MS): This approach can capture transient interactions by covalently linking proteins in close proximity before purification and identification.

  • Proximity-dependent biotin identification (BioID): By fusing a biotin ligase to YagU, proteins in close proximity become biotinylated and can be purified and identified by mass spectrometry.

  • Membrane-based yeast two-hybrid system (MYTH): Specifically designed for membrane proteins, this method can reveal interactions between membrane proteins and cytosolic or other membrane proteins.

  • Ribosome profiling: If YagU, like YqjD, interacts with ribosomes, ribosome profiling combined with YagU pull-downs could identify specific mRNAs associated with YagU-ribosome complexes .

  • Transcriptomics and proteomics: Comparing wild-type E. coli with yagU deletion mutants can reveal pathways affected by YagU's absence, providing clues to its cellular function.

For data analysis, employ advanced bioinformatics tools to integrate results from multiple experimental approaches, potentially revealing YagU's role in cellular networks and pathways.

What are the most common challenges in YagU expression and purification, and how can they be addressed?

Researchers working with YagU and similar inner membrane proteins frequently encounter several challenges:

Challenge 1: Poor expression levels

  • Solution: Use specialized E. coli strains designed for membrane protein expression. Consider the quadruple knockout strain (BL21ΔABCF) which shows improved expression for multiple outer membrane proteins .

  • Solution: Lower the expression temperature to 16-25°C and reduce inducer concentration to promote proper folding.

  • Solution: Codon-optimize the yagU gene for E. coli expression if using a synthetic construct.

Challenge 2: Protein aggregation/inclusion body formation

  • Solution: Add fusion partners known to enhance solubility (MBP, SUMO, or thioredoxin) to the N-terminus.

  • Solution: Include membrane-mimetic additives in the lysis buffer (glycerol, mild detergents).

  • Solution: Consider refolding protocols if YagU consistently forms inclusion bodies.

Challenge 3: Poor membrane insertion

  • Solution: Verify that any signal sequences are properly recognized. For some proteins, the presence of additional bands at unexpected molecular weights (as seen with Intimin expression) may indicate improper membrane insertion .

  • Solution: Employ a dual indicator system to monitor proper folding and membrane insertion.

Challenge 4: Detergent-related issues during purification

  • Solution: Screen multiple detergents for optimal extraction efficiency and protein stability.

  • Solution: Consider detergent exchange during purification if initial solubilization detergent is not ideal for downstream applications.

Challenge 5: Protein instability after purification

  • Solution: Include stabilizing additives (glycerol, specific lipids) in purification buffers.

  • Solution: Test reconstitution into nanodiscs, liposomes, or amphipols for enhanced stability.

Implementing systematic troubleshooting approaches and carefully documenting all experimental parameters will help researchers identify optimal conditions for successful YagU production.

How can researchers assess the quality and integrity of purified YagU?

Multiple quality control methods should be employed to ensure that purified YagU is properly folded, intact, and functional:

  • Size exclusion chromatography (SEC): Analyze the oligomeric state and homogeneity of purified YagU. A monodisperse peak suggests well-folded, non-aggregated protein.

  • Circular dichroism (CD) spectroscopy: Verify secondary structure content, particularly important for confirming the α-helical content expected in inner membrane proteins.

  • Thermal shift assays: Assess protein stability under various buffer conditions to optimize storage and experimental buffers.

  • Tryptophan fluorescence spectroscopy: Monitor the tertiary structure integrity by measuring intrinsic fluorescence of tryptophan residues, which are sensitive to their local environment.

  • Limited proteolysis: Well-folded membrane proteins typically show resistance to proteolysis in their transmembrane regions, while unfolded regions are more susceptible.

  • Mass spectrometry: Confirm the exact mass and sequence integrity of the purified protein, and identify any post-translational modifications.

  • Negative stain electron microscopy: Visualize purified protein to check for aggregation, homogeneity, and proper reconstitution into detergent micelles or membrane mimetics.

  • Functional assays: Develop specific assays based on predicted functions of YagU. If YagU is suspected to have similar functions to YqjD, tests for ribosome binding capability could be appropriate .

Maintaining detailed records of quality control results across different purification batches will help establish reproducible protocols and identify variables affecting protein quality.

How does YagU compare with paralogous inner membrane proteins in E. coli?

Understanding YagU in relation to similar proteins provides valuable context:

E. coli possesses several paralogous inner membrane proteins with similar structural characteristics but potentially diverse functions. For comparison, YqjD has two known paralogs: ElaB (101 amino acids, Mr of 11,306, pI 5.3) and YgaM (113 amino acids, Mr of 12,288, pI 8.0) . These proteins share key features:

  • Structural similarities:

    • All contain transmembrane motifs in their C-terminal regions (YqjD: residues 77-98; ElaB: residues 78-99; YgaM: residues 89-110)

    • They likely adopt similar membrane topologies with distinct cytoplasmic domains

  • Expression patterns:

    • YqjD, ElaB, and YgaM show similar expression patterns, being upregulated during stationary phase

    • Their expression is regulated by the stress response sigma factor RpoS

  • Functional overlap:

    • Like YqjD, ElaB and YgaM bind to ribosomes, suggesting a conserved role in translation regulation during stationary phase

    • The ribosome binding occurs at the N-terminal region of these proteins

Researchers investigating YagU should consider whether it shares these features with YqjD and its paralogs, particularly regarding growth phase-dependent expression, potential ribosome interaction, and RpoS regulation. Comparative analysis using sequence alignment tools, structural prediction algorithms, and expression profile comparisons would provide insights into functional conservation versus specialization among these proteins.

What novel approaches are emerging for studying inner membrane proteins like YagU?

Cutting-edge techniques for membrane protein research include:

  • Single-particle cryo-electron tomography: Enables visualization of membrane proteins in their native cellular environment without extraction, potentially revealing YagU's native arrangement and interactions.

  • Nanobody development: Generating YagU-specific nanobodies can facilitate crystallization, provide tools for immunoprecipitation, and enable super-resolution microscopy of YagU in vivo.

  • In-cell NMR: This emerging technique allows structural studies of proteins within living cells, providing insights into YagU structure and dynamics in its native environment.

  • Genetic code expansion: Incorporating non-canonical amino acids into YagU enables site-specific labeling for various biophysical techniques and photo-crosslinking to capture transient interactions.

  • Native mass spectrometry: Recent advances allow membrane proteins to be analyzed with their associated lipids and interaction partners, providing insights into the native state of YagU complexes.

  • Artificial intelligence approaches: Machine learning algorithms for protein structure prediction (like AlphaFold2) can provide structural models of YagU to guide experimental design, especially valuable when experimental structural determination proves challenging.

  • Microfluidic platforms: These systems enable high-throughput screening of expression and purification conditions with minimal sample consumption, accelerating optimization for challenging membrane proteins like YagU.

  • Cell-free expression systems: These bypass issues related to toxicity or inclusion body formation in cellular systems and allow direct expression into membrane mimetics.

These emerging technologies offer promising avenues to overcome traditional challenges in membrane protein research and may provide unprecedented insights into YagU structure, function, and cellular role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.