Recombinant Escherichia coli Inner membrane protein ybbJ (ybbJ)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Inner Membrane Protein ybbJ

Recombinant Escherichia coli inner membrane protein ybbJ is a protein of interest in molecular biology, particularly in studies involving membrane proteins and their functions within bacterial cells. Despite the lack of specific information on ybbJ in the provided search results, we can infer its relevance based on related proteins and general principles of recombinant protein expression.

Understanding Recombinant Proteins

Recombinant proteins are produced through genetic engineering, where a gene encoding a protein of interest is inserted into a host organism, such as Escherichia coli, to express the protein. This technique allows for large-scale production of proteins for research and therapeutic applications.

Characteristics of Inner Membrane Proteins in E. coli

Inner membrane proteins in E. coli play crucial roles in various cellular processes, including transport, signaling, and metabolism. These proteins are embedded within the inner membrane of the bacterium and can be involved in interactions with other proteins or molecules.

Research Findings on Related Proteins

While specific research findings on ybbJ are not available, studies on related proteins provide insights into the functions and characteristics of inner membrane proteins in E. coli. For example, YqjD is an inner membrane protein associated with stationary-phase ribosomes, suggesting roles in stress response and ribosome regulation .

Expression and Purification of Recombinant Proteins

Recombinant proteins like ybbJ are typically expressed in E. coli using vectors that allow for the addition of tags, such as His-tags, to facilitate purification. The purification process often involves affinity chromatography, followed by characterization using techniques like SDS-PAGE to assess purity and integrity .

Potential Applications and Future Directions

Recombinant inner membrane proteins can be used in various applications, including structural biology studies, vaccine development, and drug targeting. Further research on ybbJ could reveal its specific functions and potential applications in biotechnology or medicine.

Data Tables and Research Summaries

Given the lack of specific data on ybbJ, we can consider a hypothetical example of how such data might be presented for a similar protein:

Protein CharacteristicsDescription
Protein NameybbJ
SpeciesE. coli
TagHis-tag
Expression HostE. coli
FunctionInner membrane protein, potential roles in transport or signaling
Purity>90% (SDS-PAGE)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ybbJ; b0488; JW5065; Inner membrane protein YbbJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-152
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ybbJ
Target Protein Sequence
MMELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF AILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS WPVSASEDLGAGTHVEVIAIEGITLHIRAVSS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YbbJ and what protein family does it belong to?

YbbJ is an inner membrane protein in Escherichia coli that belongs to the NfeD (nodulation formation efficiency D) protein family. This protein family is often encoded in tandem with SPFH (stomatin, prohibitin, flotillin, and HflK/C) proteins, suggesting a close functional relationship between them. Recent structural studies have shown that YbbJ interacts with QmcA, an SPFH family protein, to form a complex that plays a role in membrane organization .

The NfeD protein family is evolutionarily conserved and has been implicated in various cellular processes, particularly those involving membrane compartmentalization and organization. In the QmcA-YbbJ complex, YbbJ's transmembrane helices serve as adhesive elements that bridge adjacent QmcA molecules, while its oligosaccharide-binding domain encapsulates the SPFH domain of QmcA .

What is known about the structural organization of the QmcA-YbbJ complex?

Recent cryo-electron microscopy (cryo-EM) studies have revealed that the QmcA-YbbJ complex forms an intricate cage-like structure composed of 26 copies of QmcA-YbbJ heterodimers. This structural arrangement provides important insights into how these proteins may function together in membrane organization .

The structural details at 2.9 Å resolution show:

ComponentStructural FeaturesFunction in Complex
YbbJTransmembrane helicesAct as adhesive elements bridging adjacent QmcA molecules
YbbJOligosaccharide-binding domainEncapsulates the SPFH domain of QmcA
QmcASPFH domainCore structural element in the complex
ComplexCage-like assembly26 heterodimers forming a higher-order structure

This structural organization suggests that the QmcA-YbbJ complex may play a role in organizing membrane microdomains or "lipid rafts" in bacterial membranes, potentially affecting various cellular processes including protein localization and membrane transport .

How can recombinant YbbJ be expressed in E. coli expression systems?

Expressing membrane proteins like YbbJ presents unique challenges compared to soluble proteins. A systematic approach involving the following methodological considerations is recommended:

Expression Vector Selection:

Recent advances in Golden Gate cloning systems have created versatile plasmid sets specifically designed for membrane protein expression. These systems allow for efficient testing of different expression conditions with high cloning efficiencies (>90%) .

For expressing inner membrane proteins like YbbJ, vectors containing the following elements are recommended:

  • T7 promoter for controlled expression

  • Appropriate tags (His, twin-strep, or avi) for purification

  • Fusion partners that may enhance membrane protein solubility and stability

  • Signal peptides for proper membrane targeting via SEC, SRP, or TatA pathways

Expression Conditions:

Optimal conditions for membrane protein expression typically differ from those for soluble proteins:

  • Lower temperatures (16-25°C) to slow protein synthesis and allow proper membrane insertion

  • Reduced inducer concentrations (0.1-0.5 mM IPTG) to prevent overwhelming the membrane insertion machinery

  • Extended expression times (overnight or longer) to maximize yield while minimizing toxicity

Host Strain Selection:

Specialized strains may improve membrane protein expression:

  • C41(DE3) and C43(DE3) strains, which were specifically isolated for membrane protein expression

  • Strains with modified ribosomes or rare tRNA supplements

  • Strains with enhanced membrane biogenesis capacity

What experimental design approaches can optimize YbbJ expression?

Design of Experiments (DoE) provides a systematic approach to optimize multiple parameters simultaneously for recombinant membrane protein expression. This methodology is particularly valuable for membrane proteins like YbbJ where multiple factors can affect expression yield and quality .

Key DoE Approach for YbbJ Expression:

  • Factor Identification:

    • Medium composition (LB, TB, M9, etc.)

    • Induction timing (OD600 at induction)

    • Inducer concentration

    • Post-induction temperature

    • Expression duration

    • Additives (glucose, glycerol, etc.)

    • Antibiotic selection

  • Experimental Matrix Design:
    A fractional factorial design can efficiently evaluate multiple factors with fewer experiments:

    ExperimentMediaOD600 at InductionInducer ConcentrationTemperatureExpression Time
    1LB0.60.1 mM IPTG16°C16h
    2TB0.61.0 mM IPTG16°C4h
    3LB1.00.1 mM IPTG25°C4h
    4TB1.01.0 mM IPTG25°C16h
    ..................
  • Response Measurement:

    • YbbJ expression level (Western blot or fluorescent tag quantification)

    • Membrane localization efficiency

    • Functional activity assays

    • Protein stability

  • Statistical Analysis:
    Analysis of variance (ANOVA) to determine significant factors and optimal conditions.

  • Validation Experiments:
    Confirmation runs under predicted optimal conditions, typically performed in triplicate to ensure reproducibility .

A similar DoE approach applied to pneumolysin expression achieved 250 mg/L of soluble, functional protein with 75% homogeneity, demonstrating the power of this methodology for optimizing recombinant protein expression .

What are the challenges in purifying membrane proteins like YbbJ and how can they be overcome?

Purifying membrane proteins presents unique challenges compared to soluble proteins due to their hydrophobic nature and requirement for detergents or lipid environments to maintain native structure.

Key Challenges and Solutions:

ChallengeMethodological Solution
Membrane extractionScreening different detergents (DDM, LMNG, CHAPS) for optimal solubilization without denaturing the protein
Protein stabilityAddition of stabilizing lipids (E. coli polar lipids, cholesterol) to purification buffers
Low expression yieldScale-up strategies and optimal expression conditions identified through DoE
Protein heterogeneitySize exclusion chromatography and analytical ultracentrifugation for quality control
Maintaining protein-protein interactionsMild solubilization conditions and co-expression strategies

For YbbJ specifically, which forms a complex with QmcA, co-expression and co-purification strategies may be necessary to obtain the functional complex. The Cryo-EM structure of the QmcA-YbbJ complex was successfully determined at 2.9 Å resolution, indicating that proper purification protocols for this complex have been established .

What advanced structural biology techniques are most effective for studying YbbJ?

Recent advances in structural biology have revolutionized the study of membrane proteins like YbbJ. The successful determination of the QmcA-YbbJ complex structure highlights effective approaches:

Cryo-Electron Microscopy (Cryo-EM):

This technique was successfully used to determine the structure of the QmcA-YbbJ complex at 2.9 Å resolution . Cryo-EM is particularly valuable for membrane protein complexes as it:

  • Doesn't require crystallization

  • Can resolve heterogeneous samples

  • Preserves the protein in a near-native environment

  • Can resolve large complexes like the 26-heterodimer QmcA-YbbJ assembly

Methodological Considerations for Optimal Cryo-EM of YbbJ:

  • Sample Preparation:

    • Screening different detergents and nanodiscs for optimal protein stability

    • Grid preparation optimization to achieve uniform ice thickness

    • Use of specialized grids (gold or graphene oxide) to improve particle orientation

  • Data Collection:

    • High-end microscopes (300kV) with energy filters and direct electron detectors

    • Motion correction and dose weighting to minimize radiation damage

    • Automated data collection for large datasets

  • Image Processing:

    • Advanced classification methods to sort conformational heterogeneity

    • Focused refinement on specific domains for higher resolution

    • Model building and validation protocols specific for membrane proteins

How can computational approaches complement experimental studies of YbbJ?

Computational methods provide valuable insights that complement experimental studies of membrane proteins like YbbJ:

Molecular Dynamics Simulations:

  • Simulate YbbJ behavior in lipid bilayers to understand membrane interactions

  • Investigate conformational changes under different conditions

  • Explore the dynamics of the QmcA-YbbJ complex assembly

Homology Modeling and Sequence Analysis:

  • Identify functional domains based on sequence conservation

  • Predict transmembrane regions and topology

  • Compare YbbJ to related proteins across bacterial species

Protein-Protein Interaction Prediction:

  • Identify potential interaction partners beyond QmcA

  • Predict interaction interfaces for experimental validation

  • Network analysis to place YbbJ in broader cellular context

Machine Learning Applications:

  • Predict optimal expression conditions based on protein sequence features

  • Identify potential functionally important residues for mutagenesis studies

  • Analyze large-scale proteomic data to understand YbbJ's role in different conditions

What protein-protein interaction studies can reveal YbbJ's functional networks?

Understanding YbbJ's interaction network can provide crucial insights into its cellular functions. Several complementary approaches can be employed:

Proximity-Dependent Biotin Labeling (BioID):

This technique was successfully used to identify YibN as an interactor of YidC . Similar approaches could identify YbbJ's interaction partners:

  • Fuse BioID to YbbJ and express in E. coli

  • Biotinylated proximity partners can be purified and identified by mass spectrometry

  • Provides in vivo context for interactions

Affinity Purification-Mass Spectrometry:

  • Pull-down experiments using tagged YbbJ followed by mass spectrometry

  • Can be performed on native membranes to maintain physiological relevance

  • Differential conditions can reveal context-dependent interactions

Genetic Interaction Screens:

  • Synthetic genetic array analysis to identify genetic interactions

  • Suppressor screens to identify proteins that can compensate for YbbJ dysfunction

  • CRISPR interference screens to identify genetic dependencies

How can researchers address conflicting data or unexpected results in YbbJ studies?

Conflicting data is common in membrane protein research. A systematic approach to resolve contradictions includes:

Methodological Considerations:

  • Experimental Context:

    • Evaluate differences in expression systems, detergents, and buffer conditions

    • Consider the effect of tags and fusion partners on protein behavior

    • Assess membrane mimetics used (detergents vs. nanodiscs vs. liposomes)

  • Data Validation Approaches:

    • Use multiple complementary techniques to verify findings

    • Perform controls to rule out artifacts from expression or purification

    • Consider native vs. recombinant protein differences

  • Resolving Structural Contradictions:

    • Cross-validate structures using different techniques (Cryo-EM, NMR, EPR)

    • Consider conformational heterogeneity and dynamic regions

    • Evaluate crystal packing effects vs. native membrane environment

As noted in a recent review on recombinant protein production in E. coli: "Despite community commitment, the critical question of what really is the metabolic burden and how it affects both host metabolism and recombinant protein production remains elusive because some experimental results are contradictory" . This highlights the importance of systematic approaches and multiple validation strategies.

How do different E. coli strains affect YbbJ expression and functionality?

The choice of E. coli strain can significantly impact membrane protein expression and functionality:

Strain-Specific Considerations for YbbJ Expression:

Strain TypeAdvantagesPotential Issues
BL21(DE3)Standard expression strain, high-level expressionMay form inclusion bodies with membrane proteins
C41(DE3)/C43(DE3)Specifically evolved for membrane protein expressionMay have reduced expression levels
Lemo21(DE3)Tunable expression to optimize membrane protein productionRequires optimization of rhamnose levels
SixPackEngineered with rare tRNAs integrated into chromosomeNewer strain with limited validation across proteins

Research has shown that specialized strains like C41(DE3) and C43(DE3) were isolated specifically for their ability to express toxic membrane proteins through mutations that modify T7 RNA polymerase activity, thus allowing better control of expression levels .

For YbbJ specifically, which forms a complex with QmcA, co-expression of both proteins may require careful strain selection to ensure proper stoichiometry and complex formation. The successful structural determination of the QmcA-YbbJ complex suggests that appropriate expression systems have been established .

What novel approaches can improve membrane insertion and folding of YbbJ?

Recent research has revealed several innovative approaches to enhance membrane protein insertion and folding:

Co-expression with Membrane Protein Biogenesis Factors:

The recent discovery that YibN enhances the production and membrane insertion of YidC substrates suggests that co-expression strategies might improve YbbJ expression . Similar approaches could include:

  • Co-expression with chaperones specific for membrane proteins

  • Co-expression with components of membrane insertion machinery

  • Co-expression with lipid biosynthesis enzymes to enhance membrane expansion

Directed Evolution Approaches:

  • Error-prone PCR to generate YbbJ variants with improved expression

  • Selection systems using antibiotic resistance or fluorescent reporters fused to YbbJ

  • Compartmentalized self-replication to evolve optimal expression conditions

Membrane Engineering:

  • Modifying E. coli membrane composition through genetic engineering

  • Supplementing with specific lipids to facilitate insertion

  • Creating strains with expanded membrane surface area

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.