Recombinant Escherichia coli Inner membrane protein ybjO (ybjO)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. To prioritize a specific tag, please inform us during your order placement.
Synonyms
ybjO; b0858; JW0842; Inner membrane protein YbjO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ybjO
Target Protein Sequence
MEDETLGFFKKTSSSHARLNVPALVQVAALAIIMIRGLDVLMIFNTLGVRGIGEFIHRSV
QTWSLTLVFLSSLVLVFIEIWCAFSLVKGRRWARWLYLLTQITAASYLWAASLGYGYPEL
FSIPGESKREIFHSLMLQKLPDMLILMLLFVPSTSRRFFQLQ
Uniprot No.
Target Background
Database Links
KEGG: ecj:JW0842
STRING: 316385.ECDH10B_0928
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
