Recombinant Escherichia coli Inner membrane protein yccF (yccF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yccF; b0961; JW0944; Inner membrane protein YccF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yccF
Target Protein Sequence
MRTVLNILNFVLGGFATTLGWLLATLVSIVLIFTLPLTRSCWEITKLSLVPYGNEAIHVD ELNPAGKNVLLNTGGTVLNIFWLIFFGWWLCLMHIATGIAQCISIIGIPVGIANFKIAAI ALWPVGRRVVSVETAQAAREANARRRFE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of yccF in E. coli?

YccF is a small inner membrane protein consisting of 148 amino acids with predicted transmembrane segments. Based on sequence analysis, it contains hydrophobic regions typical of integral membrane proteins with transmembrane helices . While its precise function in E. coli remains under investigation, research on homologous proteins suggests possible roles in membrane integrity, transport processes, or cell division machinery . The protein's hydrophobic nature indicates it is embedded within the lipid bilayer of the bacterial inner membrane, with specific regions extending into either the cytoplasm or periplasm.

How is yccF localized within bacterial cells?

Localization studies of inner membrane proteins like yccF typically employ fluorescent protein fusion techniques (such as sfGFP tagging) for visualization . Research on related inner membrane proteins suggests that yccF likely exhibits a pattern of distribution along the bacterial membrane, possibly with concentration at cellular poles as observed with other membrane proteins like YccT . The protein contains a signal peptide sequence essential for proper membrane targeting and insertion, similar to other inner membrane proteins whose localization depends on their signal sequences .

What is known about the evolutionary conservation of yccF across bacterial species?

YccF appears to be conserved across various bacterial species, including Shigella flexneri and E. coli . This conservation suggests fundamental cellular functions. Bioinformatic analysis using tools like STRING database reveals potential functional partners, though the interaction network for E. coli yccF differs from that of Bacillus subtilis yccF . The conservation pattern suggests selective pressure to maintain this protein's structure and function throughout bacterial evolution, indicating its biological significance.

What expression systems are most effective for recombinant yccF production?

For recombinant expression of inner membrane proteins like yccF, pBAD-based expression vectors have proven effective in E. coli host systems . The experimental approach should include:

  • Codon optimization for E. coli expression

  • Incorporation of appropriate fusion tags (His-tag or sfGFP) for detection and purification

  • Controlled expression using inducible promoters (arabinose-inducible systems work well)

  • Expression in specialized E. coli strains designed for membrane protein production

The inclusion of signal peptide sequences is critical for proper membrane targeting, as demonstrated in studies with other inner membrane proteins where deletion of signal sequences resulted in altered localization and function .

What purification techniques are most suitable for yccF?

Purification of inner membrane proteins like yccF requires specialized techniques:

StepMethodBuffer ConditionsCritical Considerations
Membrane IsolationDifferential centrifugationTris-based buffers (pH 7.5-8.0)Complete cell lysis is essential
SolubilizationDetergent extractionMild detergents (DDM, LDAO)Detergent selection affects protein stability
PurificationIMAC or affinity chromatographyTris buffer with 50% glycerolTag placement can impact protein folding
StorageFlash freezingOptimized stabilizing buffersAvoid repeated freeze-thaw cycles

The specific detergent choice is critical as it must effectively solubilize the protein while maintaining its native structure and function.

How can researchers effectively study yccF membrane localization and topology?

To determine yccF membrane topology and localization:

  • Generate sfGFP fusion constructs at both N and C termini to visualize cellular distribution

  • Employ protease accessibility assays to determine which regions are exposed to cytoplasm or periplasm

  • Use Phos-tag SDS-PAGE to assess phosphorylation state if relevant to function

  • Apply deconvolution microscopy to analyze the precise membrane distribution pattern

Studies on similar proteins have shown that signal peptide deletions significantly alter localization, suggesting experimental approaches that manipulate the signal sequence can provide insights into targeting mechanisms . Bipolar or unipolar distribution patterns may indicate interaction with cytoskeletal elements or other cellular machinery .

What techniques are most effective for studying yccF interactions with other proteins?

To identify and characterize protein interactions:

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation with modified protocols for membrane proteins

    • Fluorescence resonance energy transfer (FRET) for direct interaction assessment

  • In vitro approaches:

    • Surface plasmon resonance with purified components

    • Isothermal titration calorimetry for binding affinity determination

    • Pull-down assays using tag-based purification

The membrane protein drift and assembly (MPDA) system can be particularly valuable for studying interactions of membrane proteins like yccF, as it allows for the auto-assembly of membrane-tethered domains into functional protein complexes on the bacterial inner membrane .

How might yccF contribute to bacterial cellular processes based on research of similar proteins?

Research on related inner membrane proteins suggests yccF may function in:

  • Cell division processes, similar to YciB which interacts with the essential cell division protein ZipA

  • Membrane integrity maintenance

  • Signal transduction across the inner membrane

  • Transport of specific molecules

Studies of the related protein YidC have revealed that membrane proteins with unbalanced charge distributions are more likely to depend on membrane protein insertion machinery . Analysis of yccF's amino acid sequence for charge distribution could provide insights into its membrane insertion mechanisms and functional dependencies.

What structural analysis techniques are appropriate for yccF characterization?

Structural characterization of membrane proteins like yccF presents unique challenges:

  • Initial screening:

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography to determine oligomeric state

  • Advanced structural determination:

    • X-ray crystallography requiring specialized crystallization techniques for membrane proteins

    • Cryo-electron microscopy for near-native state visualization

    • Solid-state NMR for structure determination in membrane environments

  • Computational approaches:

    • Molecular dynamics simulations to model membrane interactions

    • Homology modeling based on structurally characterized homologs

Recent advances in membrane protein structural biology suggest that detergent-free systems using nanodiscs or amphipols might provide more native-like environments for structural studies of yccF.

How should researchers address contradictory findings when studying yccF function?

When faced with conflicting data:

  • Systematically evaluate experimental conditions that might explain discrepancies:

    • Expression levels (overexpression artifacts versus native expression)

    • Strain-specific effects (wild-type versus deletion mutants)

    • Tag interference with protein function

  • Design controlled experiments that specifically test contradictory hypotheses:

    • Use complementation studies with wild-type and mutant variants

    • Apply multiple independent techniques to assess the same parameter

    • Consider temperature, growth phase, and media composition differences

  • Contextual analysis:

    • Compare with findings on homologous proteins in related species

    • Consider pleiotropic effects in genetic studies

The dual roles observed for some membrane proteins, such as YccT (renamed CsgI) which functions both as an OmpR phosphorylation modulator and a CsgA polymerization inhibitor , suggest that yccF might also have multiple context-dependent functions.

How does yccF compare with other bacterial inner membrane proteins of unknown function?

When comparing yccF with other uncharacterized inner membrane proteins:

  • Sequence-based analysis:

    • Multiple sequence alignments to identify conserved motifs

    • Hydrophobicity profiles to compare transmembrane topology predictions

    • Identification of conserved functional residues

  • Phenotypic comparisons:

    • Growth characteristics of deletion mutants under various conditions

    • Sensitivity to membrane stressors

    • Cellular morphology changes

  • Interaction network analysis:

    • Overlap in protein-protein interaction networks

    • Common regulatory pathways

This comparative approach can place yccF within the broader context of bacterial membrane biology, potentially revealing functional clusters and suggesting experimental directions for functional characterization.

What experimental design strategies can optimize reproducibility in yccF research?

To ensure reproducible results when studying this challenging membrane protein:

  • Standardized expression and purification protocols:

    • Detailed documentation of growth conditions (temperature, media, induction parameters)

    • Consistent membrane extraction procedures

    • Validated quality control metrics for purified protein

  • Robust experimental design principles:

    • Include appropriate positive and negative controls

    • Implement sufficient replication (biological and technical replicates)

    • Control for batch effects in long-term studies

    • Use randomization and blinding where applicable

  • Comprehensive reporting:

    • Full methodological details including buffer compositions and incubation times

    • Raw data availability

    • Transparent analysis pipelines

Following these principles will facilitate meta-analysis and the integration of findings across different research groups, advancing our understanding of yccF function in bacterial physiology.

How might systems biology approaches enhance understanding of yccF function?

Integrative approaches to uncover yccF function could include:

  • Multi-omics strategies combining:

    • Transcriptomics to identify genes co-regulated with yccF

    • Proteomics to detect changes in protein abundance in yccF mutants

    • Metabolomics to identify pathways affected by yccF deletion

  • Network analysis:

    • Construction of functional interaction networks based on genetic interactions

    • Correlation analysis with other membrane proteins under various stress conditions

  • Genome-wide approaches:

    • Transposon mutagenesis screens to identify synthetic lethal interactions

    • CRISPR interference studies to identify condition-specific essentiality

The observation that multiple essential proteins depend on membrane protein insertion machinery suggests that systematic screening for genetic interactions could reveal the cellular pathways in which yccF participates.

What role might post-translational modifications play in regulating yccF function?

Investigation of post-translational modifications should consider:

  • Phosphorylation analysis:

    • Phos-tag SDS-PAGE to detect phosphorylated forms

    • Mass spectrometry to identify specific modified residues

    • Functional studies comparing phosphomimetic and non-phosphorylatable mutants

  • Other potential modifications:

    • Lipidation relevant to membrane association

    • Proteolytic processing affecting activity or localization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.