Recombinant Escherichia coli Inner membrane protein ycdZ (ycdZ)

Shipped with Ice Packs
In Stock

Description

Recombinant Protein Expression in E. coli: Key Pathways and Challenges

E. coli remains a dominant host for recombinant protein production due to its well-characterized genetic and metabolic systems . Critical challenges include:

  • Disulfide Bond Formation: Proteins requiring disulfide bonds often misfold in the reducing cytoplasm. Engineered strains like SHuffle (DsbC-expressing) improve folding .

  • Membrane Protein Insertion: The Sec translocon (SecYEG) and YidC are central to inner membrane protein (IMP) biogenesis. YidC assists in lateral insertion of transmembrane segments (TMSs) and folding .

  • Metabolic Burden: Overexpression disrupts host physiology, affecting growth rates, transcription, and translation machinery .

FactorImpact on Recombinant Protein Production
Disulfide BondsRequires oxidative periplasm or engineered strains (e.g., SHuffle)
Membrane ProteinYidC-dependent insertion for IMPs; Sec translocon for secretion
Metabolic LoadAlters fatty acid synthesis, transporters, and sigma factors

YidC and the Sec Translocon

YidC is a multifunctional inner membrane protein critical for IMP insertion:

  • Dual Role: Acts with the Sec translocon for cotranslational insertion and independently for small IMPs (e.g., phage coat proteins) .

  • Structure: Contains a 12-TMS topology and interacts with SRP and FtsY during targeting .

  • Functional Partners: Associates with SecDF-YajC and FtsH, suggesting roles in quality control .

SRP-Mediated Targeting

The signal recognition particle (SRP) pathway targets IMPs to the Sec translocon:

  • Mechanism: SRP binds nascent TMSs, halting translation until the ribosome docks at the SecYEG complex .

  • GTPases: SRP (Ffh) and its receptor (FtsY) drive membrane insertion via GTP hydrolysis .

T7 Promoter Systems

  • pET Vectors: Widely used for high-yield expression but risk inclusion body formation. T7 lysozyme (pLysS/E plasmids) reduces leaky expression .

  • Alternative Hosts: V. natriegens shows promise for producing aggregation-prone proteins (e.g., uricase) with optimized secretion tags .

Secretion Systems

  • HlyA/TolC System: Enables extracellular secretion of recombinant proteins fused to the HlyA C-terminal domain .

  • Flagellar T3SS: Deletion of fliD/fliC genes enhances secretion via periplasmic translocation .

Reference Genes for Transcriptional Analysis

Recent meta-analyses identified cysG, hcaT, and idnT as stable reference genes for qPCR normalization in E. coli overexpressing recombinant proteins . These genes outperform traditional references like rrsA and ihfB, which show variability under stress .

Critical Gaps and Recommendations

  • Lack of ycdZ Data: No studies in the provided sources address ycdZ. Potential reasons include:

    • Nomenclature Confusion: Possible misannotation or alternative names in the literature.

    • Novel Gene: Emerging research not yet indexed in major databases.

  • Future Directions:

    • Database Mining: Cross-reference ycdZ with E. coli genome annotations (e.g., EcoCyc, UniProt).

    • Functional Screens: Use CRISPRi/a libraries to probe ycdZ’s role in membrane protein biogenesis.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycdZ; b1036; JW5147; Inner membrane protein YcdZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ycdZ
Target Protein Sequence
MNILLSIAITTGILSGIWGWVAVSLGLLSWAGFLGCTAYFACPQGGLKGLAISAATLLSG VVWAMVIIYGSALAPHLEILGYVITGIVAFLMCIQAKQLLLSFVPGTFIGACATFAGQGD WKLVLPSLALGLIFGYAMKNSGLWLAARSAKTAHREQEIKNKA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How can I obtain recombinant YcdZ for research purposes?

Recombinant full-length YcdZ has been successfully expressed in E. coli with an N-terminal His tag . When working with this protein:

  • Expression constructs should include the full-length protein (amino acids 1-163)

  • For optimal stability, store lyophilized powder at -20°C/-80°C

  • Upon receipt, briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

What expression systems are most effective for recombinant YcdZ production?

  • Consider using specialized E. coli strains optimized for membrane protein expression

  • Explore chemically competent E. coli strains designed for high-efficiency transformation (>10^8 transformants/μg pUC19 DNA)

  • Innovative transformation systems like "Mix & Go" can streamline procedures by eliminating heat shock and long incubations

What experimental design approaches are recommended for studying YcdZ function?

The gold standard for experimental design is the randomized controlled double-blind experiment . When investigating YcdZ:

  • Implement proper randomization to eliminate human bias

  • Ensure treatment and control groups are as alike as possible

  • Consider blocking designs to control for known sources of variation

For computer experiments with quantitative factors, space-filling designs may be appropriate, especially when the experimental region is too large for simple linear or quadratic models . This approach is valuable when multiple expression conditions are being tested simultaneously.

How can I characterize YcdZ as a potential transporter or efflux pump?

While YcdZ's specific function isn't fully characterized in the provided literature, methods used for other membrane transporters can be applied. For example, with the ABC-type multidrug exporter YddA:

Assay TypeMethodPurposeNotes
MIC AssayCompare sensitivity in wildtype vs. knockout strainsDetermine substrate rangeReveals exported substrates
Fluorescence TestsMeasure accumulation of fluorescent substratesAnalyze transport kineticsCan be used with inhibitors
Inhibitor StudiesTest effects of transport inhibitorsDetermine energy coupling mechanismortho-vanadate and reserpine inhibit ATP-dependent transporters

These approaches revealed that YddA relies on energy from ATP hydrolysis for substrate transport . Similar methodologies could elucidate YcdZ's function.

What strategies can improve recombinant YcdZ expression and function?

Genetic approaches have proven effective for enhancing membrane protein expression. A study identified several gene knockouts that significantly increased expression of membrane proteins:

  • Deletion of oppF increased CyoB-GFP signal 3-fold over wild-type

  • Knockouts of nlpC, trpA, yafL, and yeaY increased CyoB-GFP more than 2-fold

  • Mutations in murP and yoaG increased MdlB-GFP signal 2-fold

  • Some deletions (yebA, ynfM, yeeA, yebS) markedly increased homogeneity of membrane protein expression

These findings suggest targeted genetic modifications could optimize YcdZ expression.

How should I design experiments to analyze potential contradictions in YcdZ functional data?

When faced with contradictory data about membrane proteins like YcdZ:

  • Determine if contradictions represent actual functional complexity rather than experimental artifacts

  • Use statistical approaches like those described in "Contradictions and Challenges for Critical Discourse Analysis" to interpret seemingly conflicting results

  • Design experiments with sufficient statistical power to detect subtle effects

Remember that "fissures are diagnostic, showing tensions in the field, not fault lines about to open up" . Contradictions may indicate multifunctional properties of YcdZ rather than experimental errors.

What approaches are recommended for analyzing structure-function relationships in YcdZ?

Structure-function analysis of YcdZ should incorporate:

  • Site-directed mutagenesis targeting key residues identified in the AlphaFold structural model

  • Expression of truncated constructs to identify functional domains

  • Chimeric proteins combining regions of YcdZ with well-characterized membrane proteins

For statistical analysis, consider sequential importance sampling strategies as described for high-dimensional tables , which can help interpret complex datasets generated from structure-function studies.

What functional assays are appropriate for characterizing YcdZ activity?

Based on approaches used for other membrane proteins:

  • Transport Assays: Monitor movement of potential substrates across membranes in proteoliposomes reconstituted with YcdZ

  • Binding Studies: Use isothermal titration calorimetry or surface plasmon resonance to measure substrate binding

  • Physiological Impact: Compare phenotypes of wildtype and ΔycdZ strains under various stress conditions

For growth inhibition studies, follow minimum threshold requirements (minimum n=3 for primary analysis, n=10 recommended for secondary analysis) to avoid disclosure issues in data reporting .

How can I optimize high-throughput screening approaches for YcdZ functional characterization?

For high-throughput screening:

  • Develop fluorescent or colorimetric assays compatible with plate-reader formats

  • Consider using PAA (People Also Ask) data mining approaches to identify potential functions based on homologous proteins

  • Implement factorial design experiments to efficiently test multiple variables simultaneously

Remember that "the goal is to make the treatment group and control group as alike as possible" to minimize confounding variables.

What are best practices for resolving technical challenges in membrane protein research?

When working with challenging membrane proteins like YcdZ:

  • Solubilization Optimization: Test a panel of detergents or membrane-mimetic systems

  • Expression Troubleshooting: Evaluate different promoters, fusion tags, and host strains

  • Stability Enhancement: Screen additives that improve protein stability after purification

  • Functional Reconstitution: Optimize lipid composition for proteoliposome studies

These approaches address common technical hurdles in membrane protein research while maintaining rigorous experimental design principles.

How should contradictory results in YcdZ functional studies be interpreted?

When analyzing potentially contradictory data:

  • Consider whether contradictions represent true biological complexity

  • Evaluate whether different experimental conditions might explain discrepancies

  • Apply statistical approaches designed for complex datasets

Research on contradictions in data analysis suggests that "the variable which determines false RT should be quite different for these two kinds of false sentences" , highlighting the importance of carefully analyzing the source of contradictions.

What statistical methods are most appropriate for YcdZ structure-function studies?

For rigorous statistical analysis:

  • Implement randomized complete block designs to control for batch effects

  • Consider latin hypercube designs for computer experiments with many variables

  • Use sequential importance sampling strategies for high-dimensional datasets

Remember that when designing experiments, "the goal is to fill the experimental space with points as well as possible (space-filling designs) in such a way that each run provides additional information even if some factors turn out to be irrelevant" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.