Recombinant Escherichia coli Inner membrane protein ycfZ (ycfZ)

Shipped with Ice Packs
In Stock

Description

Predicted Functional Partners of ycfZ

ProteinFunctionInteraction Score
YmfADUF3592 family inner membrane protein0.811
YceMPutative virulence factor (Gfo/Idh/MocA family)0.810
CyoBCytochrome o ubiquinol oxidase subunit I (respiratory chain component)0.635
CyoACytochrome o ubiquinol oxidase subunit II0.635

These interactions, inferred from bioinformatics tools like STRING , imply potential involvement in respiratory chain complexes (via CyoB/CyoA) and membrane homeostasis (via YmfA/YceM).

Research Applications

The recombinant ycfZ protein is primarily used in:

  • Structural studies (e.g., SDS-PAGE, Western blot) .

  • Interaction mapping (e.g., co-IP, pull-down assays) .

  • Membrane biology research, particularly in exploring envelope stress responses .

Challenges and Future Directions

Despite its availability, ycfZ’s precise function remains elusive. Key gaps include:

  1. Mechanistic roles in respiratory chain activity or membrane integrity.

  2. Interplay with stress response systems (e.g., Cpx/Rcs pathways) .

  3. Potential as a therapeutic target, particularly in bacterial pathogenesis.

Future studies should prioritize knockout mutagenesis and proteomic profiling to elucidate its biological relevance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycfZ; b1121; JW1107; Inner membrane protein YcfZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-262
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ycfZ
Target Protein Sequence
MKKFIILLSLLILLPLTAASKPLIPIMKTLFTDVTGTVPDAEEIAHKAELFRQQTGIAPF IVVLPDINNEASLRQNGKAMLAHASSSLSDVKGSVLLLFTTREPRLIMITNGQVESGLDD KHLGLLIENHTLAYLNADLWYQGINNALAVLQAQILKQSTPPLTYYPHPGQQHENAPPGS TNTLGFIAWAATFILFSRIFYYTTRFIYALKFAVAMTIANMGYQALCLYIDNSFAITRIS PLWAGLIGVCTFIAALLLTSKR
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is ycfZ and why is it significant for research?

Similar to characterized inner membrane proteins like YqjD and YciB, ycfZ is a predicted transmembrane protein in E. coli that likely contributes to cell envelope integrity. Its significance stems from potential roles in cell membrane organization, stress response pathways, and interactions with essential cellular machinery. Understanding ycfZ can provide insights into fundamental bacterial physiology and potentially reveal novel targets for antimicrobial development. Studies of other inner membrane proteins like YciB have demonstrated involvement in critical processes like cell elongation and division, suggesting ycfZ may participate in similarly important cellular functions .

What is known about the structure and topology of ycfZ?

While the precise experimental validation of ycfZ topology remains to be conducted, prediction algorithms suggest it contains multiple transmembrane domains. Researchers can apply methodologies similar to those used for other inner membrane proteins like YciB, which was confirmed to have five transmembrane domains using dual pho-lac reporter systems. Such systems can determine whether specific protein segments reside in the cytoplasm or periplasm, providing crucial structural information . Expression studies coupled with membrane fractionation techniques can further confirm ycfZ's localization to the inner membrane.

How does ycfZ expression change during different growth phases?

Like YqjD, which shows increased expression during stationary phase regulated by the stress response sigma factor RpoS, ycfZ expression likely varies depending on growth conditions and cellular states. Researchers should consider monitoring expression profiles across growth curves using techniques like qPCR or reporter gene fusions to identify expression patterns. Studies of membrane protein YqjD demonstrated distinct expression during stationary phase, suggesting that ycfZ may similarly show growth phase-dependent regulation .

What are the recommended E. coli strains for recombinant ycfZ expression?

For recombinant membrane protein expression, strain selection significantly impacts yield and functionality. Common expression strains for membrane proteins include BL21(DE3), C41(DE3), and C43(DE3) - the latter two being specifically engineered for membrane protein expression. When expressing membrane proteins like ycfZ, consider strains with reduced proteolytic activity or those optimized for membrane protein production. Recent advances in recombinant protein expression have addressed several bottlenecks, suggesting that optimal translation control is critical for functional protein yield .

What expression systems are optimal for functional recombinant ycfZ production?

Based on recent advances in recombinant protein production, researchers should consider pET plasmid systems with T7 RNA polymerase for controlled, high-level expression of ycfZ. The critical factor is achieving balance between expression rate and proper membrane insertion. For membrane proteins like ycfZ, lower induction temperatures (16-25°C) typically yield better results than standard 37°C protocols. Additionally, consider testing different induction methods:

Expression ParameterStandard ConditionOptimized for Membrane Proteins
IPTG Concentration1.0 mM0.1-0.5 mM
Induction Temperature37°C16-25°C
Induction Duration4-6 hours12-24 hours
Media SupplementsNoneGlycerol (0.5-1%)

Recent research indicates that translation rate control is crucial for obtaining functional recombinant membrane proteins, with slower expression often yielding better membrane integration and proper folding .

How can researchers overcome challenges in membrane protein solubilization and purification of ycfZ?

Membrane protein purification represents a significant challenge due to hydrophobicity and detergent requirements. For ycfZ purification, a multi-step approach is recommended:

  • Membrane fraction isolation using differential centrifugation (50,000 rpm for 1.5 hours at 4°C) after cell lysis, similar to methods used for other inner membrane proteins .

  • Detergent screening is critical - start with mild detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol).

  • Implement a two-step purification strategy combining affinity chromatography (His-tag) followed by size exclusion chromatography.

  • Consider nanodiscs or amphipols for stabilizing the purified protein in a membrane-like environment.

Recent advances in glycosylation pathways and disulfide bond formation in E. coli can be leveraged if ycfZ requires post-translational modifications for proper folding and function .

What approaches can identify potential protein-protein interaction partners of ycfZ?

Understanding protein interaction networks provides crucial functional insights. Recommended approaches include:

  • Bacterial two-hybrid system - this method successfully identified interaction partners for YciB with cell elongation and division proteins .

  • Co-immunoprecipitation followed by mass spectrometry analysis can reveal physiologically relevant interactions in native conditions.

  • Crosslinking coupled with mass spectrometry (XL-MS) to capture transient interactions.

  • Proximity-based labeling methods like BioID adapted for bacterial systems.

YciB studies demonstrated interactions with cell elongation and division proteins, suggesting ycfZ may similarly interact with essential cellular machinery . When investigating potential ribosomal interactions, methods used for YqjD can serve as a template, as it was shown to associate with 70S and 100S ribosomes .

How can researchers distinguish between direct and indirect effects of ycfZ deletion or overexpression?

Interpreting phenotypic data from genetic manipulations requires careful controls and complementary approaches:

  • Create precise deletion mutants using λ-Red recombination system or CRISPR-Cas9.

  • Perform complementation studies with wild-type ycfZ to confirm phenotypes are directly attributable to ycfZ loss.

  • Use point mutations in functional domains to establish structure-function relationships.

  • Consider conditional expression systems to avoid adaptation to constitutive absence/presence.

Studies of YqjD demonstrated that overexpression led to growth inhibition, indicating potential toxicity when expression exceeds physiological levels . Similar effects may occur with ycfZ overexpression, requiring careful titration of expression levels.

What bioinformatic approaches can predict ycfZ function based on sequence conservation?

Computational analysis provides valuable initial insights:

  • Conduct phylogenetic analysis across bacterial species to identify conservation patterns.

  • Perform domain analysis using tools like Pfam, SMART, and PROSITE.

  • Apply co-evolution analysis to identify potential functional partners.

  • Utilize structural prediction tools like AlphaFold2 for 3D structure modeling.

The genomic context analysis can be particularly informative - genes in the same operon or genomic neighborhood often function in related pathways. In E. coli, over 800 genes encode inner membrane proteins, many with unknown functions, suggesting systematic approaches are needed to characterize proteins like ycfZ .

How should researchers interpret contradictory experimental results regarding ycfZ function?

Contradictory results are common in membrane protein research due to complex dependencies on expression conditions. Recommended approaches include:

  • Carefully document all experimental conditions, including strain backgrounds, growth media, and physiological states.

  • Test multiple conditions to identify context-dependent effects.

  • Consider the potential impact of tagged versus untagged constructs.

  • Implement multi-omics approaches (transcriptomics, proteomics, metabolomics) to develop a comprehensive understanding.

Recent reviews highlight that experimental results regarding host metabolism and recombinant protein production can be contradictory, suggesting the need for systematic experimental approaches and potentially artificial intelligence tools to clarify complex relationships .

How does ycfZ compare to other characterized E. coli inner membrane proteins like YqjD and YciB?

Comparative analysis provides functional insights through evolutionary relationships:

FeatureYqjDYciBycfZ (Predicted)
Transmembrane DomainsContains transmembrane motif in C-terminal regionFive transmembrane domainsMultiple transmembrane domains
Expression PatternStationary phase, RpoS-regulatedNot specifiedTo be determined
Protein InteractionsAssociates with 70S and 100S ribosomesInteracts with cell elongation and division proteinsPotential interactions with membrane and cellular machinery
Phenotypic EffectsOverexpression inhibits growthDeletion causes susceptibility to low osmolarityTo be determined
ParalogsElaB, YgaMNot specifiedTo be investigated

YciB has been shown to interact with proteins involved in cell envelope synthesis and is required for normal biofilm formation , while YqjD associates with ribosomes and is expressed during stationary phase . These findings provide potential avenues for investigating ycfZ function.

What methodological approaches used with YqjD and YciB can be applied to ycfZ research?

Successful experimental approaches from related proteins include:

  • Membrane topology mapping using dual pho-lac reporter systems as applied to YciB .

  • Ribosome association studies using methods applied to YqjD .

  • Bacterial two-hybrid system for identifying protein interaction partners as used with YciB .

  • Phenotypic characterization of deletion mutants under various stress conditions, particularly osmotic stress which revealed YciB's role in cell envelope integrity .

  • Differential centrifugation for membrane fractionation (50,000 rpm for 1.5 hours at 4°C) to confirm membrane localization .

What are the current knowledge gaps regarding ycfZ and how might they be addressed?

Despite advances in membrane protein research, several challenges remain:

  • Limited structural information - addressing this gap requires optimized expression and purification protocols followed by structural biology approaches (X-ray crystallography, cryo-EM, or NMR).

  • Undefined regulation mechanisms - transcriptomics and promoter analysis across growth conditions can elucidate regulatory factors.

  • Unknown interaction partners - comprehensive interactome studies using advanced proteomics are needed.

  • Physiological function - systematic phenotypic characterization of mutants under diverse conditions will provide insights.

The development of artificial intelligence tools could help analyze complex experimental data and identify patterns that clarify ycfZ function, particularly in relation to host metabolism .

How might advances in E. coli protein expression systems impact future ycfZ research?

Recent developments in recombinant protein production systems offer new opportunities:

  • Improved glycosylation pathways in E. coli could enable better expression of properly modified ycfZ if glycosylation is required for function .

  • Enhanced disulfide bond formation systems may improve proper folding if ycfZ contains structural disulfide bonds .

  • Controlled aggregate formation techniques could be beneficial if ycfZ tends to aggregate during expression .

  • Antibiotic-independent expression systems address concerns about antibiotic resistance and provide more stable expression platforms .

Systematic optimization of translation control parameters represents a promising approach, as recent research indicates this is critical for achieving maximal yields of functional exogenous proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.