Recombinant Escherichia coli Inner membrane protein ydgK (ydgK)

Shipped with Ice Packs
In Stock

Description

Recombinant Production in E. coli

Expression Systems
ydgK is typically expressed in E. coli using T7 promoter-based systems (e.g., pET vectors) to achieve high yields. Key parameters include:

ParameterDetails
StrainBL21(DE3) or derivatives (e.g., Origami™ for disulfide bond formation)
TagN-terminal His-tag for affinity purification
InductionIPTG or arabinose (for tunable systems)
Yield~1–5 mg/L in standard cultures (varies by construct and strain)

Purification
Recombinant ydgK is purified via nickel affinity chromatography (His-tag) followed by size-exclusion chromatography (SEC) to ensure monodispersity .

Research Findings and Applications

Membrane Localization
ydgK localizes to the inner membrane fraction, as confirmed by differential centrifugation and membrane protein extraction protocols . This localization is critical for its hypothesized role in membrane-associated processes, such as ion translocation or redox reactions .

Commercial Availability
Recombinant ydgK is commercially available as a purified protein, often used in:

  • Protein-protein interaction studies (e.g., validating STRING predictions) .

  • Structural biology (e.g., crystallography or NMR studies) .

  • Vaccine development (as a component of E. coli-derived antigen preparations) .

Challenges and Future Directions

Expression Challenges

  • Solubility: ydgK may form inclusion bodies due to its hydrophobic transmembrane domains. Co-expression with molecular chaperones (e.g., GroEL/GroES) or using E. coli strains with impaired proteases (e.g., BL21(DE3) pLysS) can mitigate this .

  • Post-Translational Modifications: The reducing cytoplasm of E. coli complicates disulfide bond formation, requiring engineered strains (e.g., Origami™) for proper folding .

Future Research

  • Functional Characterization: Elucidating ydgK’s role in E. coli physiology, particularly its interactions with SoxR or nucleoid-associated proteins .

  • Therapeutic Applications: Exploring ydgK as a target for antimicrobial agents or vaccine adjuvants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such requirements in your order notes, and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
ydgK; b1626; JW1618; Inner membrane protein YdgK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-146
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ydgK
Target Protein Sequence
MTTTTPQRIGGWLLGPLAWLLVALLSTTLALLLYTAALSSPQTFQTLGGQALTTQILWGV SFITAIALWYYTLWLTIAFFKRRRCVPKHYIIWLLISVLLAVKAFAFSPVEDGIAVRQLL FTLLATALIVPYFKRSSRVKATFVNP
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YdgK and what is its primary function in Escherichia coli?

YdgK is a small inner membrane protein in Escherichia coli that appears to be expressed under specific stress conditions. While the precise function remains under investigation, evidence suggests YdgK may be involved in stress response mechanisms, particularly during stationary phase or nutrient limitation. YdgK shares sequence similarity with the bicyclomycin resistance protein homolog in Bacillus subtilis (approximately 76.5% similarity) . Like other small membrane proteins induced during stress conditions, YdgK likely contributes to membrane integrity or function during adverse environmental conditions.

YdgK belongs to a broader class of small proteins that are often overlooked in genome annotations but play crucial roles in bacterial physiology. These proteins typically contain one or more transmembrane domains and may serve as adaptors, modulators of larger protein complexes, or independent functional units responding to specific environmental cues.

How is YdgK expression regulated in E. coli?

YdgK expression appears to be regulated in response to stress conditions, similar to other small membrane proteins in E. coli. Based on studies of similar stress-induced small proteins, YdgK expression may be controlled at both transcriptional and post-transcriptional levels. Recent research on stress-induced small proteins in E. coli has demonstrated that many of these proteins show increased expression under magnesium limitation and other stress conditions .

For similar small proteins, expression regulation often involves:

  • Transcriptional control through stress-responsive sigma factors

  • Post-transcriptional regulation via small RNAs

  • Translational control mechanisms that respond to cellular stress

When studying YdgK expression patterns, researchers should consider examining both transcriptional activity (using reporter assays) and protein levels (via western blotting) under various stress conditions to fully understand its regulatory mechanisms.

What are the predicted structural features of YdgK?

YdgK is predicted to contain transmembrane domains characteristic of inner membrane proteins in E. coli. While specific structural data for YdgK is limited, bioinformatic analysis tools such as TMHMM, TMPred, and Phobius can provide predictions about its membrane topology .

Based on analyses of similar inner membrane proteins in E. coli, YdgK likely contains:

  • One or more transmembrane helices spanning the inner membrane

  • Cytoplasmic and/or periplasmic domains that may interact with other cellular components

  • Possible sites for post-translational modifications that regulate its function

To experimentally determine YdgK structure, researchers typically employ techniques such as:

  • Membrane protein crystallography (challenging but provides high-resolution structural data)

  • Cryo-electron microscopy (increasingly popular for membrane protein structure determination)

  • NMR spectroscopy (useful for dynamics studies of membrane proteins)

  • Computational modeling combined with experimental validation

How does YdgK compare to other small membrane proteins in E. coli?

E. coli expresses several small membrane proteins under stress conditions, many of which have been better characterized than YdgK. For instance, studies have identified multiple small proteins induced under magnesium limitation, with approximately 9 out of 17 stress-induced small proteins localizing to the membrane .

Comparative analysis with proteins like YdgU may provide insights into YdgK function:

ProteinSize (aa)Membrane AssociationExpression ConditionKnown Function
YdgK~100-120Inner membraneStress conditionsUnder investigation
YdgU~100Membrane-associatedMg2+ limitationPotentially involved in stress response
YoaI~100Inner membraneMg2+ limitationActivates EnvZ-OmpR system
YobF~100Membrane-associatedHeat shock, Mg2+ limitationStress response

Researchers investigating YdgK should consider comparative approaches with these better-characterized small membrane proteins to develop hypotheses about its function and regulation.

What expression systems are optimal for producing recombinant YdgK?

Producing recombinant membrane proteins presents significant challenges. For YdgK expression, researchers should consider the following approaches:

Recommended Expression Systems:

  • E. coli-based expression systems with modifications:

    • C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • LEMO21(DE3) with tunable expression levels using rhamnose

    • pBAD vector systems allowing arabinose-controlled expression levels

  • Cell-free expression systems:

    • These systems can produce membrane proteins directly into supplied lipid environments

    • Avoid aggregation issues associated with high-level cellular expression

Optimization Strategies:

  • Lower induction temperatures (16-25°C) to slow protein synthesis and improve folding

  • Addition of membrane-mimetic environments during purification (detergents, nanodiscs)

  • Fusion partners that enhance membrane protein folding and stability (e.g., GFP, MBP)

For example, fusion constructs with GFP have been successfully used to express and localize other small membrane proteins like YdgU, YmiA, YmiC, and YoaI, confirming their membrane localization . Similar approaches would likely be effective for YdgK.

What techniques are most effective for studying YdgK localization and topology?

Understanding membrane protein localization and topology is crucial for functional studies. For YdgK, researchers should consider:

Localization Techniques:

  • Fluorescent protein fusions:

    • N- or C-terminal GFP fusions, considering predicted topology to ensure proper GFP folding

    • Microscopy analysis to visualize peripheral membrane localization patterns

  • Cell fractionation and western blotting:

    • Separation of membrane and cytoplasmic fractions

    • Detection using epitope tags (e.g., 6xHis, FLAG)

Topology Determination:

  • Substituted cysteine accessibility method (SCAM):

    • Introducing cysteine residues at various positions

    • Determining accessibility to membrane-impermeable labeling reagents

  • Protease protection assays:

    • Differentiating cytoplasmic vs. periplasmic domains through selective protease digestion

From previous studies of similar proteins, researchers found that proper tag placement is crucial - some small membrane proteins showed different localization patterns depending on whether the tag was placed at the N- or C-terminus . For example, YobF-GFP appeared cytoplasmic, while 6xHis-tagged YobF showed greater association with membrane fractions .

How does deletion or overexpression of YdgK affect E. coli phenotypes?

Phenotypic analysis through gene deletion and overexpression provides valuable insights into protein function. For YdgK research, consider:

Deletion Studies:
Some small membrane proteins in E. coli show growth defects when deleted. For example, deletion of similar proteins like PmrR, YobF, YqhI, and YriAB resulted in reduced growth yields when grown under magnesium limitation over 24 hours, with cells entering stationary phase earlier than wild type . Testing YdgK deletion under various stress conditions might reveal similar phenotypes.

Recommended approaches include:

  • CRISPR-Cas9 mediated deletion for precise gene removal

  • Complementation studies to confirm phenotypes are directly related to YdgK loss

  • Growth assays under various stress conditions (nutrient limitation, pH stress, temperature)

Overexpression Studies:
Overexpression can sometimes reveal function through gain-of-function phenotypes or by disrupting normal cellular processes. Considerations include:

  • Inducible expression systems with tight regulation

  • Titration of expression levels to avoid non-specific toxicity

  • Phenotypic assays including growth rate, stress tolerance, and membrane integrity

What role might YdgK play in bacterial stress response pathways?

Based on expression patterns of similar proteins, YdgK likely contributes to bacterial stress responses. Research approaches to elucidate this function include:

Transcriptomic and Proteomic Analysis:

  • RNA-Seq comparing wild-type and ΔydgK strains under stress conditions

  • Proteomic analysis to identify interaction partners or affected pathways

  • Metabolomic profiling to identify biochemical pathways affected by YdgK deletion

Stress Response Phenotypes:

  • Testing sensitivity to various stressors (oxidative stress, osmotic stress, antibiotics)

  • Examining membrane integrity under stress conditions

  • Measuring survival during stationary phase or long-term starvation

Studies of similar membrane proteins have shown that they can contribute to specific stress response pathways. For example, YoaI has been shown to be transcriptionally controlled by the PhoRB signaling pathway and displays increased protein levels under magnesium stress .

How can systems biology approaches advance our understanding of YdgK function?

Systems biology integrates multiple data types to understand protein function within the broader cellular context. For YdgK research, consider:

Network Analysis:

  • Constructing protein-protein interaction networks through pull-down assays coupled with mass spectrometry

  • Integrating expression data across multiple stress conditions to identify co-regulated genes

  • Using these networks to predict functional associations

Computational Predictions:

  • Structural modeling combined with molecular dynamics simulations

  • Evolutionary analysis to identify conserved functional domains

  • Machine learning approaches to predict function from sequence and structural features

Multi-omics Integration:

  • Combining transcriptomics, proteomics, and metabolomics data

  • Identifying pathways affected by YdgK deletion or overexpression

  • Generating testable hypotheses about YdgK function

What is known about potential roles of YdgK in bacterial pathogenesis?

Given the relationship between stress response and virulence in many bacteria, YdgK might contribute to pathogenesis. Research approaches include:

Virulence Models:

  • Testing ΔydgK strains in infection models

  • Examining biofilm formation capacity

  • Assessing survival within host cells or tissues

Regulation During Infection:

  • Measuring ydgK expression during different stages of infection

  • Determining if host factors influence ydgK expression

  • Testing whether ydgK contributes to antibiotic tolerance during infection

The homology between E. coli YdgK and the bicyclomycin resistance protein in B. subtilis suggests potential roles in antibiotic resistance , which could contribute to bacterial survival during infection. Additionally, some E. coli membrane proteins have been implicated in urinary tract infection pathogenesis, suggesting potential roles for YdgK in similar contexts .

What are the main challenges in purifying YdgK for in vitro studies?

Membrane protein purification presents significant challenges. For YdgK purification, researchers should consider:

Critical Challenges:

  • Solubilization from the membrane

  • Maintaining protein stability outside the membrane environment

  • Obtaining sufficient quantities for biochemical/structural studies

  • Preventing aggregation during concentration

Recommended Solutions:

  • Detergent screening to identify optimal solubilization conditions:

    • Mild detergents (DDM, LMNG) often preserve membrane protein structure

    • Systematic screening of detergent types and concentrations

  • Alternative membrane mimetics:

    • Nanodiscs or SMALPs to maintain a lipid environment

    • Amphipols for increased stability during purification

  • Buffer optimization:

    • Testing various pH conditions, salt concentrations, and additives

    • Including stabilizing agents like glycerol or specific lipids

  • Affinity purification strategies:

    • Designing constructs with removable affinity tags

    • Two-step purification schemes for increased purity

How can researchers overcome difficulties in studying YdgK-protein interactions?

Identifying interaction partners for membrane proteins requires specialized approaches:

Recommended Techniques:

  • In vivo approaches:

    • Bacterial two-hybrid systems modified for membrane proteins

    • Proximity labeling techniques (BioID, APEX) to identify nearby proteins

    • Co-immunoprecipitation with crosslinking to capture transient interactions

  • In vitro approaches:

    • Reconstitution systems with purified components

    • Surface plasmon resonance (SPR) with immobilized YdgK

    • Microscale thermophoresis for detecting interactions in solution

  • Computational approaches:

    • Coevolution analysis to predict interaction partners

    • Structural modeling of potential protein-protein interfaces

    • Mining of existing interactome datasets for hints about YdgK associations

For YdgK, which is expressed during stationary phase, interactions with ribosomal components might be particularly relevant, as observed with the paralogous protein YqjD, which associates with 70S and 100S ribosomes .

What emerging technologies show promise for advancing YdgK research?

Several cutting-edge technologies could significantly advance our understanding of YdgK:

Cryo-Electron Tomography:

  • Visualizing YdgK in its native membrane environment

  • Observing structural changes under different conditions

  • Potential for in situ structural determination

Single-Molecule Techniques:

  • FRET studies to examine conformational changes

  • Single-molecule tracking to monitor dynamics within the membrane

  • Force spectroscopy to measure interaction strengths

Advanced Genetic Tools:

  • CRISPRi for tunable gene repression

  • Multiplexed genome editing to study combinatorial effects with other proteins

  • Base editing for precise amino acid substitutions without complete gene deletion

Artificial Intelligence Applications:

  • Improved structural predictions through AlphaFold and similar tools

  • Mining literature and databases to generate hypotheses about function

  • Designing experiments to efficiently explore functional space

How might understanding YdgK function contribute to broader questions in bacterial physiology?

Research on YdgK has potential implications for several fundamental questions in bacterial biology:

Stress Response Integration:

  • How do bacteria coordinate multiple stress response pathways?

  • What role do small membrane proteins play as sensors or effectors?

  • How do these systems contribute to bacterial survival in changing environments?

Ribosome Regulation:
Similar to YqjD, which associates with ribosomes and may localize them to the membrane during stationary phase , YdgK might contribute to translational regulation during stress. This could address questions about:

  • How translation is spatially organized within bacterial cells

  • The relationship between membrane association and ribosome activity

  • Post-transcriptional regulation during stress responses

Membrane Protein Evolution:

  • How have small membrane proteins evolved and diversified?

  • What functional innovations arise from gene duplication events?

  • How do bacteria adapt existing membrane proteins for new functions?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.