Recombinant Escherichia coli Inner membrane protein yeeR (yeeR)

Shipped with Ice Packs
In Stock

Description

Expression Systems for Recombinant YeeR Production

Recombinant YeeR is produced using heterologous expression systems in E. coli, yeast, baculovirus, or mammalian cells . Key parameters influencing its expression include:

Vector Design

  • Promoters: Strong promoters like T7 or trc enhance transcription but may increase metabolic burden .

  • Copy Number: Low-copy plasmids (e.g., p15A origin) improve soluble yields compared to high-copy systems .

Host Strains

  • E. coli BL21(DE3) is commonly used for T7-driven expression .

  • ackA mutants reduce acetate accumulation, optimizing growth under glycerol-based conditions .

Induction Conditions

  • IPTG (0.1–1 mM) or arabinose (0.2–2%) are standard inducers .

  • Carbon sources like glycerol minimize acetate overflow, enhancing membrane protein stability .

Metabolic Burden

High expression levels trigger resource competition, reducing cell growth and protein yield . For example, high-copy vectors with strong promoters decrease YeeR solubility by ~50% compared to low-copy systems .

Inclusion Body Formation

Aggregation-prone YeeR may require:

  • Lower induction temperatures (20–25°C) .

  • Chaperone co-expression (e.g., GroEL/GroES) .

  • Optimized solubilization buffers (e.g., 1% Triton X-100 or DDM) .

Applications and Research Implications

  • Vaccine Development: YeeR is marketed as a recombinant antigen for immunological studies .

  • Membrane Protein Studies: Serves as a model for inner membrane protein topology and transport mechanisms .

  • Systems Biology: Included in databases like EcoliOverExpressionDB to guide overexpression strategies .

Key Research Findings

  • Transcriptional Regulation: yeeR expression is repressed by the small RNA GcvB, with derepression observed in gcvB mutants .

  • Functional Analogies: YeeR shares operational parallels with LptF/LptG proteins in LPS transport, though direct involvement remains unconfirmed .

  • Yield Optimization:

    • Glycerol vs. Glucose: Glycerol-fed cultures increase soluble YeeR by 30% compared to glucose .

    • Strain Engineering: ΔackA mutants improve YeeR titers by 2.3-fold under acetate-limiting conditions .

Future Directions

  • Structural Characterization: Cryo-EM studies are needed to resolve YeeR’s 3D architecture.

  • Pathway Elucidation: CRISPRi/a screens could identify interactors in membrane biogenesis .

  • Industrial Scaling: Continuous bioreactor trials may enhance yield for biotherapeutic applications .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of your specified tag.
Synonyms
yeeR; b2001; JW1983; Inner membrane protein YeeR
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-510
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yeeR
Target Protein Sequence
MLQIVGALILLIAGFAILRLLFRALISTASALAGLILLCLFGPALLAGYITERITRLFHI RWLAGVFLTIAGMIISFMWGLDGKHIALEAHTFDSVKFILTTALAGGLLAVPLQIKNIQQ NGITPEDISKEINGYYCCFYTAFFLMACSACAPLIALQYDISPSLMWWGGLLYWLAALVT LLWAASQIQALKKLTCAISQTLEEQPVLNSKSWLTSLQNDYSLPDSLTERIWLTLISQRI SRGELREFELADGNWLLNNAWYERNMAGFNEQLKENLSFTPDELKTLFRNRLNLSPEAND DFLDRCLDGGDWYPFSEGRRFVSFHHVDELRICASCGLTEVHHAPENHKPDPEWYCSSLC RETETLCQEIYERPYNSFISDATANGLILMKLPETWSTNEKMFASGGQGHGFAAERGNHI VDRVRLKNARILGDNNARNGADRLVSGTEIQTKYCSTAARSVGAAFDGQNGQYRYMGNNG PMQLEVPRDQYAGAVETMRNKIREGKVEER
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of E. coli inner membrane protein YeeR?

YeeR (P76361) is a 510-amino acid inner membrane protein encoded by the yeeR gene (also designated as b2001 or JW1983) in Escherichia coli . As a full-length membrane protein, YeeR contains multiple transmembrane domains that anchor it within the bacterial inner membrane. The amino acid sequence reveals a complex protein with specific hydrophobic and hydrophilic regions typical of membrane-integrated proteins .

While the precise function of YeeR remains under investigation, preliminary research suggests it may participate in membrane integrity, transport processes, or cellular signaling pathways. Unlike the better-characterized YeeJ protein, which functions as an inverse autotransporter involved in bacterial adhesion , YeeR's physiological role requires further elucidation through targeted functional studies and comparative analyses with other membrane proteins.

Current structural information is limited, with no published crystal structure available. Researchers typically rely on computational predictions and experimental approaches like circular dichroism or limited proteolysis to gain insights into secondary structure elements.

What expression systems are optimal for recombinant YeeR production?

Recombinant YeeR production presents challenges common to membrane proteins. The most successful expression system documented is homologous expression in E. coli, which maintains the native cellular environment for proper protein folding and membrane insertion . When using E. coli expression systems, consider these approaches:

The addition of an N-terminal His-tag has proven effective for purification while maintaining protein functionality . Alternative tags (FLAG, GST) may be considered if His-tagged constructs show limited solubility or activity.

For optimal results, use T7-based expression vectors with temperature reduction to 18-20°C after induction to minimize inclusion body formation. Supplementing the media with glucose (0.5-1%) can reduce basal expression and potential toxicity before induction.

How should recombinant YeeR be stored and handled in the laboratory?

Proper storage and handling are critical for maintaining YeeR stability and functionality. Based on established protocols for similar membrane proteins and specific recommendations for YeeR:

The purified YeeR protein is typically provided as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, add glycerol to a final concentration of 50% and store in small aliquots at -20°C or preferably -80°C .

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. Working aliquots can be maintained at 4°C for up to one week . The recommended storage buffer is Tris/PBS-based with 6% trehalose at pH 8.0, which helps maintain protein stability .

When handling purified YeeR:

  • Centrifuge vials briefly before opening to collect all material at the bottom

  • Use low-protein binding tubes for storage

  • Keep samples on ice during experimental procedures

  • Consider adding protease inhibitors for extended work sessions

  • Document all freeze-thaw events for each aliquot

What are the primary applications of recombinant YeeR in academic research?

Recombinant YeeR serves multiple research purposes in academic settings:

  • Structural Biology: Purified recombinant YeeR provides material for structural studies using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy. These approaches help elucidate the three-dimensional organization of membrane proteins, though they present significant technical challenges.

  • Functional Characterization: Recombinant YeeR enables investigation of protein-protein interactions, potential enzymatic activities, and involvement in cellular processes through in vitro assays and reconstitution experiments.

  • Antibody Production: Purified YeeR can be used as an antigen for developing specific antibodies, enabling immunolocalization studies and detection methods.

  • Comparative Studies: As part of broader investigations into bacterial membrane biology, YeeR can be compared with other membrane proteins to identify conserved structural or functional elements.

  • Method Development: The challenging nature of membrane protein research makes YeeR a useful model for developing improved techniques for expression, purification, and characterization of integral membrane proteins.

Applications typically begin with SDS-PAGE analysis to confirm protein purity and integrity before proceeding to more specialized biochemical or biophysical characterization methods .

What techniques are most effective for studying protein-protein interactions of YeeR?

Investigating YeeR's protein-protein interactions requires specialized approaches due to its membrane-embedded nature. The following methods are particularly effective:

Co-immunoprecipitation (Co-IP) with Membrane-Specific Modifications:
Solubilize membranes with mild detergents (0.5-1% DDM, CHAPS, or digitonin) before immunoprecipitation to maintain native interactions. Cross-linking with membrane-permeable agents (DSP or formaldehyde) prior to solubilization can capture transient interactions.

Pull-Down Assays Using Recombinant Tagged YeeR:
The His-tagged YeeR construct provides an excellent tool for pull-down experiments . Immobilize purified YeeR on Ni-NTA resin and incubate with bacterial lysates to identify binding partners. Eluted complexes can be analyzed by mass spectrometry to identify interacting proteins.

Surface Plasmon Resonance (SPR):
SPR allows real-time, label-free measurement of binding kinetics between YeeR and potential interaction partners. Reconstitute purified YeeR in nanodiscs or liposomes before immobilization on the sensor chip to maintain a membrane-like environment.

Bacterial Two-Hybrid Systems:
Specialized systems like BACTH (Bacterial Adenylate Cyclase Two-Hybrid) are adapted for membrane proteins and can screen for potential interactions in a cellular context.

Proximity Labeling:
BioID or APEX2 fusions to YeeR can identify neighboring proteins in vivo through proximity-dependent biotinylation, providing a spatial interactome in the native membrane environment.

The below table compares the effectiveness of these methods:

MethodSensitivityNative ConditionsThroughputTechnical DifficultyLimitations
Modified Co-IPMediumMediumLowMediumDetergent effects on interactions
Pull-DownHighLowMediumLowNon-physiological conditions
SPRVery HighMediumLowHighComplex setup for membrane proteins
Bacterial Two-HybridMediumHighHighMediumPotential false positives
Proximity LabelingHighVery HighMediumHighUnable to distinguish direct vs. proximal

What are the challenges in crystallizing membrane proteins like YeeR?

Membrane protein crystallization presents several unique challenges compared to soluble proteins:

Detergent Micelle Complexity:
The detergent micelle surrounding the hydrophobic regions of YeeR creates a heterogeneous particle that hinders regular crystal lattice formation. Screening multiple detergents (including DDM, OG, LDAO) and employing detergent mixtures is essential for finding optimal crystallization conditions.

Limited Hydrophilic Surface Area:
Membrane proteins typically have reduced hydrophilic regions available for crystal contacts. For YeeR, consider fusion protein approaches (e.g., T4 lysozyme or BRIL insertions) to increase hydrophilic surface area and facilitate crystal packing.

Conformational Heterogeneity:
Membrane proteins often exhibit conformational flexibility. Stabilizing YeeR through ligand binding, antibody fragments, or protein engineering (thermostabilizing mutations) can promote homogeneity for crystallization.

Lipid Requirements:
Many membrane proteins require specific lipids for stability and function. Supplementing crystallization trials with E. coli lipid extracts or specific phospholipids can improve success rates.

Alternative Approaches:
When traditional crystallization proves challenging, consider:

  • Lipidic cubic phase (LCP) crystallization

  • Cryo-electron microscopy (Cryo-EM)

  • NMR studies on selectively labeled protein

  • X-ray free-electron laser (XFEL) with microcrystals

Success rates for membrane protein crystallization remain significantly lower than for soluble proteins (~5-10% vs. 30-40%). Plan for extensive screening (>1000 conditions) and iterative optimization.

How can site-directed mutagenesis be applied to study YeeR function?

Site-directed mutagenesis represents a powerful approach to probe structure-function relationships in YeeR. Based on the 510-amino acid sequence , targeted mutations can reveal functional domains and mechanistic insights:

Key Residue Selection Strategies:

  • Conserved residues across homologs suggest functional importance

  • Charged residues within transmembrane domains (unusual and often functional)

  • Predicted binding pockets or catalytic sites

  • Potential phosphorylation or glycosylation sites

  • Residues at predicted membrane interfaces

Mutation Types and Their Applications:

Mutation TypeRationaleExpected OutcomeAnalysis Method
Alanine ScanningRemoves side chain interactions without altering backboneIdentifies essential residuesActivity/binding assays
Conservative SubstitutionsMaintains chemical properties (D→E, K→R)Tests specificity requirementsFunctional assays
Charge ReversalDramatically alters electrostatics (D→K)Disrupts electrostatic interactionsBinding/localization studies
Cysteine SubstitutionEnables disulfide mapping or labelingStructural informationCrosslinking/accessibility
Tryptophan IntroductionLarge hydrophobic probeMembrane positioningFluorescence spectroscopy

Experimental Approach:

  • Generate mutations using Q5 or QuikChange mutagenesis on expression plasmids

  • Verify mutations by sequencing

  • Express mutant proteins in parallel with wild-type controls

  • Assess effects on expression, localization, stability, and function

  • For transmembrane domains, analyze membrane integration using PhoA/LacZ fusion reporters

The YeeR protein sequence contains multiple regions of interest for mutagenesis, including potential transmembrane helices and conserved motifs that could be targeted systematically .

What methodologies effectively analyze YeeR localization in bacterial cells?

Determining the precise subcellular localization of YeeR provides crucial insights into its function. Several complementary approaches can be employed:

Fluorescent Protein Fusions:
C-terminal fusions of YeeR with msfGFP or mCherry allow visualization of localization patterns in live cells. N-terminal fusions may interfere with membrane targeting and should be validated carefully. Consider photoactivatable fluorescent proteins for super-resolution microscopy.

Immunofluorescence Microscopy:
Using antibodies against the His-tag or YeeR-specific antibodies allows detection of native or recombinant protein after fixation and permeabilization. This approach avoids potential artifacts from fluorescent protein fusions but requires careful optimization of fixation and permeabilization protocols to preserve membrane structures.

Subcellular Fractionation:
Separate inner membrane, outer membrane, cytoplasmic, and periplasmic fractions using differential centrifugation and selective extraction. Analyze YeeR distribution by Western blotting using His-tag antibodies . Include known marker proteins for each fraction as controls.

Protease Accessibility Assays:
Determine membrane topology by treating intact cells, spheroplasts, or inverted membrane vesicles with proteases like trypsin or proteinase K. Protected fragments identified by Western blotting can reveal which portions of YeeR are exposed to each cellular compartment.

Electron Microscopy:
Immunogold labeling with antibodies against YeeR or its affinity tag provides high-resolution localization data. Correlative light and electron microscopy (CLEM) combines the advantages of fluorescence and electron microscopy for comprehensive analysis.

For quantitative analysis of localization patterns, consider the following table format:

Cellular FractionYeeR Signal IntensityMarker ProteinNotes
Inner Membrane++++SecY (+++++)Primary localization
Outer Membrane-OmpA (+++++)No significant signal
Cytoplasm+GroEL (+++++)Minor signal, possibly synthesis intermediates
Periplasm-MalE (+++++)No detectable signal

How does YeeR protein sequence analysis inform functional predictions?

The 510-amino acid sequence of YeeR can be analyzed using computational tools to predict functional elements and guide experimental design:

Transmembrane Domain Prediction:
Tools like TMHMM, Phobius, and MEMSAT predict YeeR contains multiple transmembrane helices. Consensus predictions help identify reliable transmembrane segments versus ambiguous regions.

Conserved Domain Analysis:
Search for known domains using PFAM, CDD, or InterPro databases. While YeeR may contain domains with low similarity to characterized families, even weak matches can suggest functional categories.

Sequence Conservation Analysis:
Multiple sequence alignment of YeeR homologs from diverse bacterial species reveals evolutionarily conserved residues likely important for structure or function. Use ConSurf or similar tools to map conservation onto predicted structural models.

Structural Modeling:
While no crystal structure exists for YeeR, AlphaFold2 or RoseTTAFold can generate predicted models based on the amino acid sequence . These models, while requiring experimental validation, can suggest functional sites and protein architecture.

Functional Motif Identification:
Scan for sequence motifs associated with enzyme activity, protein-protein interactions, or post-translational modifications. Tools like PROSITE, ELM, or ScanProsite can identify potential functional signatures.

An example of sequence analysis results might be presented as:

Analysis MethodPredictionConfidenceResidue RangeFunctional Implication
TMHMM7 transmembrane helicesHigh25-47, 78-100, etc.Integral membrane protein
PFAMPF07624 (Transport protein)Low156-320Possible transport function
ConSurfConserved charged clusterHigh215-230Potential active/binding site
NetPhosPhosphorylation sitesMediumT120, S243, Y290Regulatory mechanisms
AlphaFold2Structural modelMediumFull proteinCentral cavity suggests channel/transporter

What purification strategies yield the highest purity for recombinant YeeR?

Purifying membrane proteins like YeeR requires specialized approaches to maintain protein integrity while achieving high purity. Based on established protocols for His-tagged membrane proteins , a multi-step purification strategy is recommended:

Membrane Preparation and Solubilization:

  • Harvest E. coli cells expressing YeeR-His by centrifugation (5000×g, 15 min, 4°C)

  • Resuspend in buffer containing 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 1 mM EDTA, protease inhibitors

  • Disrupt cells by sonication or high-pressure homogenization

  • Remove unbroken cells and debris (10,000×g, 20 min, 4°C)

  • Collect membranes by ultracentrifugation (100,000×g, 1 hour, 4°C)

  • Solubilize membrane fraction in buffer containing 1-2% detergent (n-dodecyl-β-D-maltoside, DDM)

Immobilized Metal Affinity Chromatography (IMAC):

  • Equilibrate Ni-NTA resin with wash buffer (50 mM Tris-HCl pH 8.0, 200 mM NaCl, 0.1% DDM, 20 mM imidazole)

  • Incubate solubilized membranes with resin (2-4 hours or overnight at 4°C)

  • Wash extensively with increasing imidazole concentrations (20, 40, 60 mM)

  • Elute YeeR-His with elution buffer containing 250-300 mM imidazole

Size Exclusion Chromatography (SEC):
To remove aggregates and achieve higher purity, perform SEC using a Superdex 200 column in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM.

Alternative Purification Methods:
For specialized applications, consider:

  • Ion exchange chromatography as an orthogonal purification step

  • Affinity chromatography using antibodies against YeeR

  • Cobalt-based IMAC for reduced non-specific binding

The purification efficiency can be assessed at each step using SDS-PAGE analysis, with expected purity exceeding 90% after the complete protocol . Western blotting with anti-His antibodies confirms the identity of purified YeeR.

How can YeeR activity be reliably measured in vitro?

Without established functional assays specific to YeeR, researchers must develop appropriate activity measurements based on hypothesized functions. Several approaches can be considered:

Binding Assays:
If YeeR functions as a receptor or binding protein, measure interaction with potential ligands using:

  • Microscale Thermophoresis (MST): Detects binding-induced changes in thermophoretic mobility

  • Isothermal Titration Calorimetry (ITC): Measures heat changes during binding events

  • Fluorescence-based assays: Monitor intrinsic tryptophan fluorescence changes upon ligand binding

Transport Assays:
If YeeR functions in transport:

  • Reconstitute purified protein into liposomes or proteoliposomes

  • Load vesicles with fluorescent substrates

  • Measure substrate uptake or efflux over time

  • Compare with control liposomes without YeeR

Structural Integrity Assessment:
Monitor protein stability and conformational changes using:

  • Circular Dichroism (CD): Assesses secondary structure content

  • Differential Scanning Fluorimetry (DSF): Measures thermal stability

  • Limited Proteolysis: Identifies flexible/protected regions

Functional Complementation:
Express YeeR in yeeR-knockout E. coli strains and assess restoration of phenotypes:

  • Growth rates under various stress conditions

  • Membrane integrity using permeability assays

  • Metabolite profiles using mass spectrometry

When reporting activity measurements, include detailed information on:

  • Protein concentration and purity

  • Buffer composition and pH

  • Temperature and incubation times

  • Controls for non-specific effects

  • Statistical analysis of replicate measurements

What controls should be included in YeeR functional assays?

Robust controls are essential for reliable interpretation of YeeR functional data:

Negative Controls:

  • Heat-denatured YeeR protein (95°C, 10 minutes)

  • Buffer-only samples without protein

  • Irrelevant membrane protein of similar size/topology

  • YeeR with mutated key residues (if identified)

  • Empty liposomes/expression vectors (for transport/in vivo assays)

Positive Controls:

  • Well-characterized membrane proteins with established activities

  • Native membrane preparations containing YeeR

  • Synthetic peptides corresponding to functional domains (if identified)

  • Chemical compounds with known effects on membrane properties

Validation Controls:

  • Concentration-dependent responses to establish specificity

  • Competitive inhibition assays

  • Time-course measurements to establish reaction kinetics

  • Assays performed under varying buffer conditions (pH, ionic strength)

Technical Controls:

  • Multiple batches of purified protein to assess preparation variability

  • Multiple detection methods to confirm observations

  • Internal standards for quantitative measurements

  • Replicate measurements (minimum triplicate) for statistical analysis

A comprehensive experimental design might include:

SampleDescriptionPurpose
1Purified YeeR (0.1 mg/mL)Test sample
2Purified YeeR (0.05 mg/mL)Concentration dependence
3Heat-denatured YeeRNegative control
4YeeR + competitive inhibitorSpecificity control
5Known membrane transporterPositive control methodology
6Buffer onlyBackground control
7-9Replicates of samples 1-6Statistical validity

How can protein-lipid interactions of YeeR be characterized?

As a membrane protein, YeeR's function may depend on specific lipid interactions. Several techniques can characterize these interactions:

Lipidomics Analysis:

  • Co-purify YeeR with bound lipids

  • Extract lipids using chloroform/methanol mixtures

  • Identify and quantify lipids by mass spectrometry

  • Compare with lipid profiles of control membrane preparations

Fluorescence-Based Approaches:

  • Reconstitute YeeR in liposomes with varying lipid compositions

  • Include fluorescent lipid analogs (NBD-PE, dansyl-PE) to monitor interactions

  • Measure Förster resonance energy transfer (FRET) between labeled protein and lipids

  • Monitor fluorescence anisotropy changes upon protein-lipid binding

Native Mass Spectrometry:

  • Analyze intact YeeR-lipid complexes using nanoelectrospray ionization

  • Identify specifically bound lipid species

  • Determine binding stoichiometry

  • Assess binding strength through collision-induced dissociation

Molecular Dynamics Simulations:

  • Create computational models of YeeR in various lipid environments

  • Simulate protein behavior and lipid interactions

  • Identify potential lipid binding sites

  • Guide experimental design for validation studies

Differential Scanning Calorimetry (DSC):

  • Measure thermal stability of YeeR in different lipid environments

  • Identify lipid compositions that enhance protein stability

  • Characterize thermodynamic parameters of protein-lipid interactions

A comparative assessment of lipid effects on YeeR stability might be presented as:

Lipid CompositionTm (°C)ΔH (kJ/mol)Relative Activity (%)Notes
POPE/POPG (3:1)65.2420100Native-like composition
POPC only58.738075Reduced stability
POPE/CL (9:1)67.8455115Enhanced stability
DMPC/Cholesterol52.331045Significant destabilization
Nanodiscs (MSP1D1)68.9460110Optimal system for studies

What are common problems in recombinant YeeR expression and how can they be addressed?

Expression of membrane proteins like YeeR frequently encounters technical challenges. Here are common problems and their solutions:

Low Expression Levels:

  • Problem: Toxic effects on host cells or protein degradation

  • Solutions:

    • Use tightly regulated expression systems (pET with C41/C43 strains)

    • Lower induction temperature (16-20°C)

    • Include glucose in pre-induction media to prevent leaky expression

    • Try fusion partners that enhance stability (MBP, SUMO)

    • Add protease inhibitors during cell lysis

Inclusion Body Formation:

  • Problem: Protein aggregation instead of membrane integration

  • Solutions:

    • Reduce expression rate (lower IPTG concentration: 0.1-0.2 mM)

    • Co-express with chaperones (GroEL/ES, DnaK/J)

    • Optimize signal sequences for membrane targeting

    • Consider refolding protocols if necessary

Poor Solubilization:

  • Problem: Inefficient extraction from membranes

  • Solutions:

    • Screen multiple detergents (DDM, LMNG, CHAPS, digitonin)

    • Optimize detergent:protein ratio

    • Try native nanodisks or SMALPs for detergent-free extraction

    • Include lipids during solubilization

Protein Instability:

  • Problem: Rapid degradation after purification

  • Solutions:

    • Maintain constant low temperature (4°C)

    • Add stabilizing agents (glycerol, trehalose)

    • Identify and optimize buffer conditions (pH, salt)

    • Store in small aliquots to avoid freeze-thaw cycles

The table below summarizes a systematic troubleshooting approach:

StageProblemDiagnostic TestPotential Solutions
ExpressionLow yieldSDS-PAGE/Western blot of whole cellsChange host strain, reduce temperature
Membrane preparationPoor membrane integrationFractionation analysisOptimize signal sequence, expression conditions
SolubilizationInefficient extractionDetergent screeningTest different detergents, detergent:protein ratios
PurificationImpurities/contaminantsSDS-PAGE analysisAdditional chromatography steps, wash optimization
StorageActivity lossFunctional assays over timeGlycerol/trehalose addition, -80°C storage

How should conflicting data in YeeR research be interpreted and resolved?

When faced with contradictory results in YeeR studies, a systematic approach to data reconciliation is essential:

Source Evaluation:

  • Assess methodological differences between conflicting studies

  • Consider protein construct variations (full-length vs. truncated, tag position)

  • Evaluate different expression systems and purification methods

  • Examine experimental conditions (pH, temperature, buffers)

Technical Validation:

  • Repeat key experiments with appropriate controls

  • Use orthogonal techniques to verify observations

  • Perform dose-response or time-course studies

  • Ensure protein is properly folded and active

Biological Context:

  • Consider strain-specific differences in E. coli

  • Evaluate growth conditions that may affect protein expression or function

  • Assess potential post-translational modifications

  • Examine protein-protein interactions that may modulate function

Resolution Strategies:

  • Direct Comparison: Reproduce both conflicting methods in parallel

  • Hybrid Approach: Combine elements of different protocols

  • Extended Characterization: Expand the experimental parameter space

  • Collaborative Resolution: Engage with authors of conflicting studies

When reporting reconciled data, present a transparent analysis:

StudyKey FindingMethodologyPotential VariablesReconciled Interpretation
Study AYeeR binds substrate XSPR with detergentDetergent may affect bindingBinding occurs but is detergent-sensitive
Study BNo binding observedITC with nanodiscsLipid composition may be criticalSpecific lipids required for binding
Current workBinding dependent on lipidsMultiple techniquesSystematic variation of conditionsYeeR requires specific lipid environment for substrate X binding

What data visualization approaches best represent YeeR experimental results?

Effective data visualization is crucial for communicating complex findings about membrane proteins like YeeR:

Structural Data Visualization:

  • Ribbon or cartoon diagrams highlighting transmembrane domains

  • Surface representations colored by hydrophobicity/electrostatics

  • Topology diagrams showing membrane orientation

  • Integration of experimental data (crosslinking, accessibility) onto structural models

Functional Data:

  • Enzyme kinetics: Michaelis-Menten or Lineweaver-Burk plots

  • Binding studies: Saturation curves with Scatchard analysis

  • Transport assays: Time-course plots with initial rate determination

  • Stability studies: Thermal denaturation curves with transition temperatures

Comparative Analyses:

  • Heatmaps for multiple condition screening

  • Radar charts for multidimensional parameter comparison

  • Forest plots for meta-analysis of multiple studies

  • Principal component analysis for complex datasets

Integration with Statistical Analysis:

  • Include error bars representing standard deviation or standard error

  • Show individual data points alongside averages

  • Clearly indicate sample size and statistical significance

  • Use color coding consistently across related figures

For multiparameter optimization experiments, consider table formats that highlight optimal conditions:

Parameter 1Parameter 2Parameter 3Yield (mg/L)Purity (%)Activity (%)
Condition ACondition BCondition C0.57560
Condition ACondition BCondition D0.86585
Condition ACondition ECondition C1.29095
Condition FCondition ECondition C2.595100

When designing figures, prioritize clarity over complexity, ensure accessibility (consider color blindness), and maintain consistent formatting across related visualizations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.