Recombinant Escherichia coli Inner membrane protein ygbE (ygbE)

Shipped with Ice Packs
In Stock

Description

YgbP (LytB)

  • Function: Catalyzes the synthesis of 4-diphosphocytidyl-2-C-methylerythritol, a key intermediate in the terpenoid biosynthesis pathway .

  • Structure:

    • 26 kDa protein with a homodimeric structure .

    • Post-translational removal of the N-terminal methionine .

  • Expression: Hyperexpressed in recombinant E. coli strains under T5 promoter control .

YqjD

  • Function: Inner membrane protein associated with stationary-phase ribosomes; regulates ribosome localization and growth inhibition .

  • Regulation: Expression controlled by the RpoS stress response sigma factor .

  • Domains:

    • N-terminal ribosome-binding region.

    • C-terminal transmembrane helix .

YjgP/YjgQ (LptF/LptG)

  • Function: Transmembrane components of an ABC transporter required for lipopolysaccharide (LPS) transport to the outer membrane .

  • Topology:

    • Six transmembrane helices each .

    • Essential for E. coli viability .

YgiS

  • Function: Probable deoxycholate-binding periplasmic protein involved in bile acid resistance .

  • Recombinant Use: Produced in E. coli with >90% purity for biochemical studies .

Recommendations for Further Research on YgbE

  1. Verify Gene Annotation: Cross-reference the ygbE gene identifier (e.g., UniProt or EcoGene) to confirm its existence and current nomenclature.

  2. Functional Homology: Investigate paralogs or orthologs of YgbE in other organisms for inferred functions.

  3. Experimental Characterization:

    • Cloning and expression of ygbE in recombinant systems (e.g., pET vectors) .

    • Localization studies using membrane fractionation .

    • Interaction assays to identify binding partners or metabolic pathways.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ygbE; b2749; JW2719; Inner membrane protein YgbE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ygbE
Target Protein Sequence
MRNSHNITLTNNDSLTEDEETTWSLPGAVVGFISWLFALAMPMLIYGSNTLFFFIYTWPF FLALMPVAVVVGIALHSLMDGKLRYSIVFTLVTVGIMFGALFMWLLG
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YgbE protein and what are its basic structural characteristics?

YgbE is an inner membrane protein from Escherichia coli consisting of 107 amino acids. The full amino acid sequence is: MRNSHNITLTNNDSLTEDEETTWSLPGAVVGFISWLFALAMPMLIYGSNTLFFFIYTWPFFLALMPVAVVVGIALHSLMDGKLRYSIVFTLVTVGIMFGALFMWLLG. Based on its sequence characteristics, it appears to contain multiple transmembrane domains with hydrophobic regions that anchor it within the bacterial inner membrane . Structural predictions suggest YgbE likely contains multiple alpha-helical regions that span the membrane.

How is recombinant YgbE typically expressed for research applications?

For research applications, recombinant YgbE is typically expressed with an N-terminal His-tag in E. coli expression systems. The full-length protein (amino acids 1-107) with UniProt ID P46141 is commonly produced with this configuration to facilitate purification while maintaining functional properties . Expression vectors containing the ygbE gene under control of inducible promoters are transformed into E. coli strains optimized for membrane protein expression.

What are the recommended storage conditions for recombinant YgbE protein?

Purified recombinant YgbE protein should be stored at -20°C or -80°C for long-term stability. To prevent protein degradation from repeated freeze-thaw cycles, it is advisable to aliquot the protein upon initial reconstitution. For working solutions, storage at 4°C is recommended for up to one week . The optimal storage buffer typically contains Tris/PBS with 6% trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw cycles.

What expression systems are most effective for producing functional YgbE protein?

While several expression systems can be used, E. coli remains the preferred host for recombinant YgbE production due to its native origin. For optimal expression, consider these methodological approaches:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coli BL21(DE3)High expression, native environmentMay require optimization of induction parameters1-5 mg/L culture
E. coli C41/C43Designed for membrane proteinsLower toxic effects than standard strains0.5-3 mg/L culture
Cell-free systemsAvoids toxicity issuesHigher cost, may require membrane mimeticsVariable

For membrane proteins like YgbE, slower induction using lower IPTG concentrations (0.1-0.5 mM) at reduced temperatures (16-25°C) often improves proper membrane insertion and folding compared to standard protocols.

What purification strategy should be employed for His-tagged YgbE protein?

Purification of His-tagged YgbE requires specific considerations due to its membrane-embedded nature:

  • Membrane isolation: Harvest cells and disrupt by sonication or French press in buffer containing protease inhibitors

  • Membrane solubilization: Extract membranes with appropriate detergents (typically 1% DDM, LDAO, or OG)

  • IMAC purification: Apply solubilized fraction to Ni-NTA columns with detergent-containing buffers

  • Wash steps: Include 20-40 mM imidazole to reduce non-specific binding

  • Elution: Use 250-500 mM imidazole in detergent-containing buffer

  • Size exclusion chromatography: For higher purity, perform SEC as a polishing step

The resulting protein should achieve >90% purity as determined by SDS-PAGE analysis . For functional studies, detergent exchange or reconstitution into lipid nanodiscs may be necessary.

What reconstitution methods are recommended for functional studies of YgbE?

For functional characterization, YgbE should be reconstituted from its lyophilized form in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of 5-50% glycerol is recommended for stability, with 50% being optimal for long-term storage . For functional membrane studies, reconstitution into proteoliposomes or nanodiscs may be required to maintain the native membrane environment.

How can isotope labeling of YgbE be optimized for structural studies?

For NMR or other structural studies requiring isotope labeling, consider:

  • Minimal media preparation: Use M9 minimal media supplemented with appropriate carbon sources (^13C-glucose) and nitrogen sources (^15N-ammonium chloride)

  • Growth adaptation: Implement a stepwise adaptation of expression strains to minimal media before induction

  • Expression optimization: Reduce temperature to 18°C and extend expression time to 16-20 hours

  • Selective labeling: For specific amino acid labeling, use auxotrophic strains or metabolic precursors

Isotopically labeled YgbE can be purified using standard protocols, but yields may be 40-60% lower than in rich media. Additional concentration steps may be required to achieve sufficient protein concentrations for structural analysis.

What approaches can be used to investigate YgbE's membrane topology and orientation?

Understanding the topology of YgbE requires specialized techniques:

  • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and assess accessibility to membrane-impermeable reagents

  • Protease protection assays: Limited proteolysis of inside-out or right-side-out membrane vesicles

  • Fluorescence quenching: Position-specific fluorescent labeling with membrane-restricted quenchers

  • In silico prediction validation: Compare experimental results with topology predictions from TMHMM, TOPCONS, or similar algorithms

Data from these complementary approaches should be integrated to establish a consensus topology model for YgbE within the inner membrane.

How does YgbE function compare to other inner membrane proteins with similar structures?

While the specific function of YgbE is not fully elucidated, comparative analysis with other inner membrane proteins can provide insights. Sequence alignment and structural comparison should focus on:

  • Conserved motifs within transmembrane domains

  • Similarity to characterized transport proteins or channels

  • Evaluation of potential binding sites for substrates or interacting proteins

  • Phylogenetic distribution among related bacterial species

Notably, when comparing membrane proteins, researchers should be cautious about confusing different proteins with similar names. For example, YbhE (distinct from YgbE) has been identified as the Pgl gene encoding 6-phosphogluconolactonase in E. coli , demonstrating the importance of precise protein identification in comparative studies.

What strategies can address low expression yields of recombinant YgbE?

When encountering low expression yields:

  • Optimize codon usage for E. coli expression

  • Test different promoter systems (T7, tac, ara)

  • Evaluate fusion partners that may enhance expression or solubility

  • Screen multiple E. coli strains specialized for membrane protein expression (C41, C43, Lemo21)

  • Implement temperature and induction optimization series

A systematic approach testing combinations of these variables in small-scale cultures can identify optimal conditions before scaling up production.

How can aggregation of purified YgbE be prevented during concentration or storage?

Membrane protein aggregation is a common challenge. To mitigate this with YgbE:

  • Maintain detergent concentration above critical micelle concentration (CMC) throughout all steps

  • Include glycerol (5-50%) in all buffers to stabilize the protein

  • Consider adding specific lipids (0.1-0.5 mg/mL) that may stabilize the native conformation

  • Use gentle concentration methods such as centrifugal concentrators with higher MWCO (50-100 kDa) than the protein size

  • Monitor aggregation using dynamic light scattering during concentration steps

If aggregation persists despite these measures, screening different detergents or detergent mixtures may identify better conditions for specific downstream applications.

What controls should be included when assessing YgbE protein-protein interactions?

For reliable protein-protein interaction studies:

  • Negative controls:

    • Empty vector/tag-only controls to assess non-specific binding

    • Irrelevant membrane protein of similar size/topology

    • Heat-denatured YgbE to identify structure-dependent interactions

  • Positive controls:

    • Known interacting partners of other membrane proteins using the same methodology

    • Artificially dimerized constructs if oligomerization is being studied

  • Validation approaches:

    • Confirm interactions using at least two independent methods (e.g., pull-down and FRET)

    • Perform competition assays with unlabeled protein

    • Map interaction domains through truncation or mutation analysis

What methods are recommended for assessing YgbE incorporation into artificial membrane systems?

To confirm proper incorporation into artificial membranes:

  • Flotation assays: Density gradient centrifugation to separate proteoliposomes from free protein

  • Dynamic light scattering: Measure size distribution of proteoliposomes or nanodiscs

  • Electron microscopy: Negative staining to visualize protein-containing particles

  • Fluorescence techniques: Monitor incorporation using labeled protein or lipids

  • Protease protection assays: Confirm proper orientation in reconstituted systems

Quantitative assessment of incorporation efficiency can be performed by comparing protein content before and after reconstitution using suitable protein quantification methods.

How can researchers distinguish between functional and non-functional forms of YgbE?

Without established functional assays specifically for YgbE, researchers can employ these approaches:

  • Circular dichroism: Compare secondary structure profiles with predicted models

  • Thermal stability assays: Assess protein stability in different conditions

  • Binding assays: Screen for potential ligands or substrates based on structural predictions

  • Genetic complementation: Test if recombinant YgbE can rescue phenotypes in ygbE knockout strains

  • Membrane integrity assays: Evaluate if YgbE affects membrane permeability or integrity

When planning functional studies, researchers should consider potential similarities to related membrane proteins and design experiments that can test multiple possible functions.

How should researchers interpret discrepancies between predicted and experimental data for YgbE?

When encountering discrepancies:

  • Evaluate the quality of experimental data: Consider signal-to-noise ratio, reproducibility, and potential artifacts

  • Assess prediction algorithm limitations: Different prediction tools have varying accuracy for membrane proteins

  • Consider post-translational modifications: Experimental samples may contain modifications not accounted for in predictions

  • Examine tag interference: N-terminal His-tags may affect structure or function

  • Compare native vs. recombinant contexts: Expression system differences may alter protein behavior

Systematic investigation of these factors can help resolve discrepancies and lead to refined models of YgbE structure and function.

What statistical approaches are appropriate for analyzing YgbE protein interaction data?

For robust analysis of interaction data:

  • Implement appropriate replication: Minimum of 3-4 biological replicates

  • Apply statistical tests suitable for the data distribution:

    • Parametric tests (t-test, ANOVA) for normally distributed data

    • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal distributions

  • Include multiple comparison corrections (e.g., Bonferroni, FDR) when testing multiple conditions

  • Establish clear significance thresholds before analysis

  • Report effect sizes alongside p-values to indicate biological significance

Combining quantitative statistical analysis with qualitative evaluation of interaction characteristics provides the most comprehensive assessment of YgbE interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.