Recombinant Escherichia coli Inner membrane protein ygiZ (ygiZ)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of YgiZ

YgiZ is encoded by the ygiZ gene (synonyms: ECK3018, JW2995, b3027) in E. coli K-12. It is annotated as an inner membrane protein with no enzymatic activity directly characterized to date. Key features include:

  • Gene Location: Chromosomal locus b3027 .

  • Protein Structure: Predicted transmembrane domains with cytoplasmic N- and C-termini, consistent with inner membrane topology .

  • Post-Translational Modifications: No glycosylation sites reported; functions independently of prosthetic groups .

Production of Recombinant YgiZ

Recombinant YgiZ is generated using heterologous expression systems. Commercial and research-grade variants differ in host systems and purity:

Table 1: Recombinant YgiZ Production Platforms

Host SystemPurityApplicationsSource
Cell-Free Expression≥85% (SDS-PAGE)Structural studiesMyBioSource
E. coli≥85% (SDS-PAGE)Functional assays, ELISAsCSB ELISA
Baculovirus/Mammalian≥90% (SDS-PAGE)Antibody productionCreative BioMart

Purification typically involves affinity chromatography, with yields ranging from 0.02 mg to 50 µg depending on the scale .

Functional Role in Ca²⁺-Mediated Genetic Transformation

YgiZ is implicated in modulating plasmid uptake efficiency during Ca²⁺-induced competence. Key findings from transcriptomic and proteomic studies include:

  • Upregulation Under Ca²⁺ Stress: YgiZ expression increases during Ca²⁺ treatment, correlating with membrane remodeling and stress response pathways .

  • Gene Knockout Effects: Deletion of ygiZ significantly enhances transformation efficiency:

Table 2: Transformation Efficiency of ΔygiZ Mutants vs. Wild-Type E. coli DH5α

Plasmid Size (kb)Wild-Type Efficiency (CFU/µg)ΔygiZ Efficiency (CFU/µg)Fold Increase
2.7 (pUC19)1.0 × 10⁶1.24 × 10⁶1.24×
5.9 (pET-32a)6.3 × 10⁵1.33 × 10⁶2.12×
12.4 (p1304)2.2 × 10⁴6.0 × 10⁴2.75×

Mechanistically, ΔygiZ strains exhibit altered membrane permeability without morphological changes, facilitating plasmid internalization .

Applications in Research and Industry

  • Genetic Engineering: Used to optimize plasmid transformation protocols for synthetic biology .

  • Antibody Development: Rabbit polyclonal antibodies against YgiZ enable Western blot and ELISA applications .

  • Membrane Protein Studies: Serves as a model for analyzing inner membrane protein dynamics and topology .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
ygiZ; b3027; JW2995; Inner membrane protein YgiZ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ygiZ
Target Protein Sequence
MLKQKIKTIFEALLYIMLTYWLIDSFFAFNKYDWMLESGGNICSIPSVSGEDRILQAMIA AFFLLTPLIILILRKLFMREMFEFWVYVFSLGICLVCGWWLFWGRFIFCY
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW2995

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YgiZ and what is its role in Escherichia coli?

YgiZ is an inner membrane protein in Escherichia coli that plays a significant role in cellular response to calcium ions (Ca²⁺). It has been identified as one of the key genes involved in Ca²⁺-mediated competence formation, which is crucial for genetic transformation processes. Research indicates that YgiZ may function as a regulatory protein that influences membrane permeability and cellular response to environmental stressors. This protein is particularly noteworthy for its involvement in transformation efficiency, as demonstrated by studies showing significant changes in transformation capabilities when the gene is deleted or modified . As part of the membrane proteome, YgiZ contributes to maintaining cellular homeostasis and mediating responses to external stimuli, particularly calcium ions.

How is the ygiZ gene structured and expressed in E. coli?

The ygiZ gene in E. coli spans approximately 541 base pairs in the wild-type strain. Its expression appears to be regulated in response to calcium treatment, suggesting that it forms part of a stress response pathway. Transcriptomics and proteomics analyses have identified ygiZ among 333 differentially expressed genes and 145 differentially expressed proteins following calcium treatment . The gene's expression is likely controlled through regulatory networks that respond to changes in environmental conditions, particularly those affecting membrane integrity or permeability. In experimental contexts, researchers have successfully manipulated this gene using homologous recombination techniques, replacing it with FRT-kan-FRT fragments that result in amplification lengths of 1,958 bp before kan fragment elimination and 373 bp after elimination .

What cellular processes is YgiZ involved in?

YgiZ is primarily involved in cellular processes related to membrane function, transmembrane transport, and stress response pathways. Research data shows that YgiZ participates in:

  • Ca²⁺-mediated competence formation for genetic transformation

  • Regulation of membrane permeability

  • Cellular response to environmental stress factors

  • Potentially influencing cell morphology, as ΔygiZ mutants show altered length/width ratios (4.32 compared to 2.64 for wild type)

These processes are interconnected and contribute to the bacterium's ability to adapt to changing environmental conditions, particularly in response to calcium ions which play a crucial role in genetic transformation processes.

What techniques are most effective for creating ygiZ gene deletion mutants?

The Red homologous recombination method has proven highly effective for creating ygiZ gene deletion mutants in E. coli. This technique involves several key steps:

  • Preparation of targeting fragments using plasmid pKD4 as a template for PCR amplification

  • Creation of E. coli DH5α/pKD46 competent cells

  • Homologous substitution of the target gene with FRT-kan-FRT fragments

  • Confirmation of successful deletion through PCR amplification and sequencing

When implementing this approach, researchers should design primers that specifically target the ygiZ gene (theoretical FRT-kan-FRT length of 1,766 bp) and verify successful deletion by comparing amplification lengths before and after kan fragment elimination . It's crucial to maintain strict aseptic conditions throughout the process and to store the resulting mutants appropriately in glycerol. This method allows for precise genetic manipulation without disrupting adjacent genes, making it ideal for studying YgiZ function through loss-of-function analyses.

How can transformation efficiency be accurately measured in ygiZ mutant strains?

Accurate measurement of transformation efficiency in ygiZ mutant strains requires a methodical approach that accounts for multiple variables. The following protocol has been validated in research settings:

  • Extract plasmids (e.g., pUC19, pET-32a, p1304) from wild-type and mutant strains using a column plasmid DNA extraction kit

  • Perform transformations under standardized conditions (e.g., 100 mM CaCl₂)

  • Calculate transformation efficiency using the formula:

    TE=D×C×TvB×vQTE = \frac{D \times C \times T}{v_B \times v_Q}

    Where:

    • D = dilution degree

    • C = plate colony number

    • T = volume of conversion solution (μL)

    • v₍B₎ = volume of coating bacterial solution (μL)

    • v₍Q₎ = plasmid quality number (ng)

  • Include appropriate controls (e.g., aseptic water-treated wild-type and mutant strains)

  • Conduct statistical analysis to determine significance of differences

This methodology enables quantitative comparison of transformation efficiencies between wild-type and ΔygiZ mutant strains, revealing that deletion of ygiZ can increase transformation efficiency by 1.68 times for pUC19 and 2.12 times for pET-32a plasmids .

What protocols should be followed to analyze YgiZ protein expression and localization?

Analysis of YgiZ protein expression and localization requires a combination of molecular and cellular techniques:

  • Protein Expression Analysis:

    • Quantitative reverse transcription PCR (qRT-PCR) using the ΔΔCт algorithm to measure gene expression

    • Western blotting with YgiZ-specific antibodies to quantify protein levels

    • Proteomics approaches (e.g., mass spectrometry) to detect changes in protein abundance

  • Protein Localization Studies:

    • Fluorescent tagging of YgiZ with reporter proteins (e.g., GFP)

    • Immunofluorescence microscopy using anti-YgiZ antibodies

    • Subcellular fractionation to isolate inner membrane components followed by immunoblotting

    • Electron microscopy for high-resolution localization

  • Functional Analysis:

    • Flow cytometry to assess membrane permeability differences between wild-type and ΔygiZ strains

    • Membrane potential assays to evaluate the impact of YgiZ on electrochemical gradients

    • Calcium flux measurements to determine YgiZ's role in calcium homeostasis

When implementing these protocols, it's essential to include appropriate controls and standardize experimental conditions to ensure reproducibility and reliability of results. Research has shown that ΔygiZ mutant strains exhibit altered membrane permeability, which can be quantified through flow cytometry analysis showing a 3% increase in the positive cell ratio compared to wild-type E. coli DH5α after 100 mM CaCl₂ treatment .

How does YgiZ influence calcium-mediated competence formation in E. coli?

YgiZ appears to function as a regulatory element in calcium-mediated competence formation through several potential mechanisms:

  • Membrane Permeability Regulation: YgiZ likely modulates membrane permeability, as evidenced by flow cytometry data showing altered membrane characteristics in ΔygiZ mutants. The deletion of ygiZ increases the positive cell ratio by approximately 3% following CaCl₂ treatment compared to wild-type strains .

  • Morphological Influences: ΔygiZ mutants exhibit significant changes in cell morphology, with an increased length/width ratio of 4.32 compared to 2.64 in wild-type E. coli . This morphological alteration may create conditions more favorable for DNA uptake during transformation.

  • Stress Response Pathway Integration: YgiZ appears to be part of a calcium-responsive stress pathway. Transcriptome and proteome analyses reveal that YgiZ is among the genes significantly regulated during calcium treatment, suggesting its involvement in cellular adaptation to this stimulus .

  • Transformation Efficiency Enhancement: The most direct evidence of YgiZ's role comes from transformation studies showing that ΔygiZ mutants demonstrate significantly higher transformation efficiencies (1.68-2.12 times greater) for various plasmids compared to wild-type strains . This indicates that YgiZ may normally function to restrict DNA uptake or integration during transformation.

These findings collectively suggest that YgiZ serves as a regulatory checkpoint in calcium-mediated competence formation, potentially limiting transformation under normal conditions. Its deletion appears to remove this restriction, facilitating enhanced DNA uptake and transformation efficiency.

What interactions occur between YgiZ and other membrane proteins during stress response?

While the complete interactome of YgiZ remains to be fully characterized, current research suggests several important interactions with other proteins during stress response:

  • Co-expression Networks: Transcriptome and proteome analyses indicate that YgiZ is co-expressed with other genes involved in cell membrane components, transmembrane transport, and stress response pathways . This suggests functional relationships within these networks.

  • Potential Interaction Partners: YgiZ may interact with other differentially expressed membrane proteins identified in calcium treatment studies, including YiaW and OsmB, which also show significant effects on transformation efficiency when deleted .

  • Regulatory Pathways: Though not explicitly demonstrated, YgiZ may interact with regulatory proteins that mediate calcium signaling and stress response pathways in E. coli.

  • Functional Redundancy: The partial overlap in phenotypes between ΔygiZ, ΔyiaW, and ΔosmB mutants suggests potential functional redundancy or complementary roles among these proteins in response to calcium-induced stress .

Future research using techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking mass spectrometry would be valuable for mapping the specific protein-protein interactions involving YgiZ. Understanding these interactions would provide deeper insights into YgiZ's role in coordinating cellular responses to calcium and other stressors.

How does YgiZ deletion affect bacterial physiology beyond transformation efficiency?

The deletion of YgiZ has several notable effects on bacterial physiology beyond the well-documented enhancement of transformation efficiency:

  • Morphological Changes: ΔygiZ mutants exhibit a significantly altered morphology with a length/width ratio of 4.32 compared to 2.64 in wild-type E. coli . This suggests YgiZ plays a role in maintaining normal cell shape and division processes.

  • Membrane Permeability: Flow cytometry analysis demonstrates that ΔygiZ mutants show altered membrane permeability characteristics, with a 3% increase in positive cell ratio after calcium treatment . This indicates YgiZ contributes to membrane integrity regulation.

  • Stress Response Modulation: Though not explicitly quantified in the available data, the co-regulation of YgiZ with stress response genes suggests it may play a role in adaptation to various environmental stressors beyond calcium.

  • Potential Metabolic Effects: Given YgiZ's role as an inner membrane protein potentially involved in transmembrane transport, its deletion may affect nutrient uptake and metabolic processes, though specific metabolic alterations await further characterization.

  • Growth Dynamics: Research protocols examining ΔygiZ mutants typically include growth curve analysis, suggesting potential differences in growth rates or patterns compared to wild-type strains, though specific growth data is not provided in the available search results.

These physiological changes highlight the multifunctional nature of YgiZ and suggest that beyond its role in transformation, this protein contributes to fundamental aspects of bacterial cell structure, membrane function, and stress adaptation.

How should contradictory data on YgiZ function be reconciled in research studies?

When encountering contradictory data regarding YgiZ function, researchers should implement a systematic approach to reconciliation:

  • Methodological Comparison: Examine differences in experimental methods, including:

    • Strain backgrounds (e.g., laboratory vs. clinical isolates)

    • Growth conditions and media composition

    • Gene deletion techniques (complete deletion vs. point mutations)

    • Assay conditions and measurement parameters

  • Contextual Analysis: Consider the cellular and environmental context of each study:

    • Presence of calcium or other divalent cations

    • Growth phase of bacteria

    • Stress conditions applied

    • Media composition differences

  • Quantitative Re-analysis: Implement statistical approaches to evaluate:

    • Effect sizes across studies

    • Confidence intervals and statistical power

    • Potential for systematic bias in measurement techniques

  • Biological Variables:

    • Evaluate potential polar effects on adjacent genes in deletion mutants

    • Consider compensatory mechanisms that may mask phenotypes

    • Assess potential redundancy with functionally related proteins

  • Integrative Approach: Develop an integrated model that:

    • Incorporates apparently contradictory findings into a larger biological context

    • Proposes testable hypotheses to resolve contradictions

    • Identifies environmental or genetic factors that modulate YgiZ function

For example, differences in transformation efficiency enhancements observed in ΔygiZ mutants across studies might be reconciled by considering variations in calcium concentrations, plasmid sizes, or bacterial growth phases used in different experimental protocols .

What statistical approaches are most appropriate for analyzing YgiZ mutant phenotypes?

  • For Transformation Efficiency Studies:

    • Analysis of variance (ANOVA) followed by appropriate post-hoc tests (e.g., Tukey's HSD) for comparing multiple strains and plasmid types

    • Student's t-test with appropriate corrections for multiple comparisons when examining pairwise differences

    • Calculation of fold-change with 95% confidence intervals rather than simply reporting p-values

  • For Growth and Morphology Analysis:

    • Repeated measures ANOVA for growth curve analysis

    • Non-parametric tests (e.g., Mann-Whitney U) for morphological parameters that may not follow normal distributions

    • Linear mixed-effects models for experiments with nested designs or multiple variables

  • For Gene Expression Data:

    • The ΔΔCт algorithm for qRT-PCR data analysis with appropriate reference genes

    • Multiple test correction (e.g., Benjamini-Hochberg) for transcriptome and proteome datasets

    • Enrichment analysis for functional categorization of differentially expressed genes/proteins

  • Sample Size Determination:

    • Power analysis should be conducted a priori to determine appropriate sample sizes

    • For transformation efficiency studies, biological replicates from independent cultures are essential

  • Data Presentation:

    • Box plots or violin plots to display distribution characteristics

    • Include individual data points when sample sizes are small

    • Report both statistical significance and effect sizes

Research on YgiZ has successfully employed statistical approaches to demonstrate significant differences in transformation efficiencies (p < 0.001) between wild-type and ΔygiZ mutant strains, with transformations conducted in at least three biological replicates to ensure reproducibility .

How can transcriptomic and proteomic data be integrated to understand YgiZ's role in cellular pathways?

Integrating transcriptomic and proteomic data provides a comprehensive understanding of YgiZ's role in cellular pathways:

  • Multi-omics Data Collection:

    • Conduct parallel RNA-seq and proteomics (e.g., LC-MS/MS) on wild-type and ΔygiZ strains

    • Include multiple time points following calcium treatment to capture dynamic responses

    • Analyze subcellular fractions (membrane, cytosolic) separately for protein localization insights

  • Correlation Analysis:

    • Calculate Pearson or Spearman correlations between transcript and protein levels

    • Identify discordant gene-protein pairs that may indicate post-transcriptional regulation

    • Cluster genes and proteins based on expression patterns across conditions

  • Pathway Analysis:

    • Conduct Gene Ontology (GO) enrichment analysis on both datasets

    • Use KEGG pathway mapping to identify affected cellular processes

    • Apply gene set enrichment analysis (GSEA) to detect subtle but coordinated pathway changes

  • Network Reconstruction:

    • Build protein-protein interaction networks centered on YgiZ

    • Integrate differential expression data to identify activated/repressed network modules

    • Use algorithms such as WGCNA to identify co-expression modules

  • Validation Approaches:

    • Confirm key findings with targeted experiments (qRT-PCR, Western blots)

    • Use ChIP-seq or similar techniques to identify regulatory interactions

    • Implement functional assays to verify predicted pathway alterations

Current research has identified 333 differentially expressed genes (317 upregulated and 16 downregulated) and 145 differentially expressed proteins (54 upregulated and 91 downregulated) in response to calcium treatment . These genes and proteins are predominantly associated with cell membrane components, transmembrane transport, and stress response pathways, providing context for understanding YgiZ's functional role. Further integration of these datasets would reveal whether changes in YgiZ expression correlate with specific pathway activations or repressions.

What novel approaches could advance our understanding of YgiZ structure-function relationships?

Several innovative approaches could significantly enhance our understanding of YgiZ structure-function relationships:

  • Advanced Structural Biology Techniques:

    • Cryo-electron microscopy to determine the three-dimensional structure of YgiZ in its native membrane environment

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions and conformational changes in response to calcium

    • Single-particle analysis to capture different conformational states

  • Genetic Engineering Approaches:

    • CRISPR-Cas9 mediated precise point mutations to identify critical residues for YgiZ function

    • Creation of chimeric proteins with domains from related membrane proteins to identify functional modules

    • Site-directed mutagenesis of predicted calcium-binding sites to test direct calcium interaction hypotheses

  • Real-time Imaging Techniques:

    • Single-molecule fluorescence resonance energy transfer (smFRET) to monitor conformational changes in living cells

    • Super-resolution microscopy to track YgiZ localization and dynamics during calcium response

    • Correlative light and electron microscopy (CLEM) to connect YgiZ localization with ultrastructural features

  • Computational Approaches:

    • Molecular dynamics simulations to model YgiZ behavior in membrane environments

    • Machine learning approaches to predict functional partners based on co-expression data

    • Evolutionary analysis to identify conserved features across bacterial species

  • Functional Proteomics:

    • Proximity labeling techniques (e.g., BioID, APEX) to identify proteins physically associated with YgiZ

    • Thermal proteome profiling to detect proteins whose stability is affected by YgiZ deletion

    • Crosslinking mass spectrometry to capture direct protein interactions

These approaches would build upon current research that has primarily used gene deletion and phenotypic characterization to understand YgiZ function , providing mechanistic insights into how this protein influences transformation efficiency and other cellular processes.

How might YgiZ function differ across various E. coli strains and growth conditions?

The function of YgiZ likely varies across E. coli strains and environmental conditions due to several factors:

  • Strain-Specific Differences:

    • Laboratory strains (e.g., DH5α) versus pathogenic or environmental isolates may show different YgiZ expression patterns and functional outcomes

    • Genetic background effects may alter the phenotypic consequences of YgiZ deletion

    • Strain-specific regulatory networks may differently modulate YgiZ expression

  • Growth Phase Dependence:

    • YgiZ function may vary between exponential and stationary growth phases

    • Expression levels may change during different stages of bacterial growth

    • Interactions with other proteins may be growth phase-dependent

  • Environmental Modulation:

    • Beyond calcium, other divalent cations (e.g., Mg²⁺, Zn²⁺) might influence YgiZ function

    • pH, temperature, or osmolarity variations could alter YgiZ activity or expression

    • Nutrient availability may affect the importance of YgiZ in cellular physiology

  • Stress Response Variations:

    • Different stress conditions may trigger alternative YgiZ-dependent pathways

    • Antibiotic exposure might reveal additional roles for YgiZ in drug resistance

    • Oxidative or envelope stress responses may intersect with YgiZ function

  • Comparative Analysis Framework:

    • Systematic comparison across E. coli pathovars (UPEC, EHEC, ETEC, etc.)

    • Testing in minimal versus rich media to assess nutritional influences

    • Evaluation under diverse stress conditions to build a comprehensive functional profile

Current research has predominantly focused on laboratory strain E. coli DH5α under specific calcium treatment conditions (100 mM CaCl₂) . Expanding these studies to diverse strains and conditions would provide insights into the contextual nature of YgiZ function and potentially identify strain-specific adaptations related to this protein.

What potential biotechnological applications could emerge from manipulating YgiZ expression?

Manipulation of YgiZ expression presents several promising biotechnological applications:

  • Enhanced Genetic Engineering Tools:

    • Development of ΔygiZ E. coli strains as superior transformation hosts for difficult-to-transform constructs

    • Creation of inducible ygiZ knockdown systems for temporary enhancement of transformation efficiency

    • Design of optimized competent cell preparation protocols based on YgiZ function

  • Protein Production Systems:

    • Engineering strains with modified YgiZ expression for improved membrane protein production

    • Development of stress-resistant production strains with altered membrane permeability characteristics

    • Creation of specialized chassis strains optimized for different classes of recombinant proteins

  • Synthetic Biology Applications:

    • Incorporation of YgiZ-based regulatory modules into synthetic genetic circuits

    • Development of calcium-responsive genetic switches based on YgiZ-dependent pathways

    • Engineering cellular communication systems utilizing YgiZ-mediated membrane properties

  • Fundamental Research Tools:

    • Creation of YgiZ-based biosensors for calcium or membrane stress detection

    • Development of model systems for studying membrane protein regulation

    • Establishment of high-throughput screening platforms for membrane-active compounds

  • Potential Therapeutic Applications:

    • Identification of compounds targeting YgiZ or YgiZ-like proteins in pathogenic bacteria

    • Development of novel approaches to modulate bacterial transformation in environmental or clinical settings

    • Engineering probiotics with modified stress responses through YgiZ manipulation

Research has demonstrated that deletion of ygiZ significantly increases transformation efficiency for various plasmids (1.68-fold for pUC19, 2.12-fold for pET-32a) , providing proof-of-concept for biotechnological applications focused on genetic engineering and recombinant DNA technology.

What controls are essential when studying YgiZ function in transformation assays?

When conducting transformation assays to study YgiZ function, several essential controls must be implemented:

  • Strain Controls:

    • Wild-type parental strain (positive control)

    • Complemented ΔygiZ mutant (restoration control)

    • Alternative gene deletion strains (specificity control)

    • Negative control strains treated with aseptic water instead of DNA

  • Plasmid Controls:

    • Multiple plasmid sizes to test size-dependent effects (e.g., pUC19, pET-32a, p1304)

    • Empty vector controls

    • Plasmids with different origins of replication

    • Known quantities of plasmid DNA to establish standard curves

  • Treatment Controls:

    • Variable calcium concentrations (0, 50, 100, 150 mM CaCl₂)

    • Alternative divalent cation treatments (e.g., Mg²⁺, Mn²⁺)

    • Heat-shock and non-heat-shock conditions

    • Time course sampling to capture transformation dynamics

  • Technical Controls:

    • Multiple biological replicates from independent cultures

    • Technical replicates for transformation reactions

    • Measurement of cell viability pre- and post-transformation

    • Verification of plasmid integrity after extraction

  • Validation Controls:

    • PCR verification of transformants

    • Phenotypic confirmation of transformants (e.g., antibiotic resistance)

    • Assessment of plasmid stability in transformants

    • Verification of deletion strain genotype stability

Research protocols have successfully implemented many of these controls, including aseptic water-treated negative control groups, multiple plasmid types of different sizes, and appropriate biological replication to ensure statistical validity of observations regarding YgiZ's impact on transformation efficiency .

How can the physiological relevance of in vitro YgiZ findings be validated in vivo?

Validating the physiological relevance of in vitro YgiZ findings in vivo requires a multi-faceted approach:

  • Animal Model Studies:

    • Mouse colonization models to assess ΔygiZ mutant fitness in the gastrointestinal tract

    • Infection models (if using pathogenic E. coli strains) to evaluate virulence impacts

    • Competition assays between wild-type and ΔygiZ mutants in vivo

    • Tissue-specific bacterial recovery and enumeration

  • Environmental Simulation:

    • Growth in simulated intestinal fluid to mimic host environments

    • Biofilm formation assays under physiologically relevant conditions

    • Exposure to host-derived antimicrobial peptides and stress factors

    • Community competition assays with commensal microbiota members

  • Host Cell Interaction Studies:

    • Adhesion and invasion assays with relevant host cell types

    • Host immune response measurements when exposed to wild-type versus ΔygiZ strains

    • Survival within macrophages or other immune cells

    • Host cell cytokine and inflammatory marker production

  • Gene Expression Analysis:

    • In vivo expression profiling of ygiZ during colonization or infection

    • RNA-seq of bacteria recovered from animal models

    • Promoter-reporter fusions to track ygiZ expression in different host niches

    • Comparative proteomics of bacteria grown in vitro versus recovered from animals

  • Horizontal Gene Transfer Assessment:

    • Measurement of conjugation or transformation frequencies in intestinal environments

    • Tracking of antibiotic resistance gene transfer in the presence/absence of YgiZ

    • Assessment of phage transduction efficiency in vivo

While specific in vivo validation of YgiZ function is not detailed in the available search results, similar approaches have been used to validate the importance of membrane proteins in bacterial fitness and virulence. For example, search result mentions that "YhiM was required for optimal fitness of UPEC in a mouse model of UTI," suggesting similar methodologies could be applied to assess YgiZ's physiological relevance .

How does YgiZ compare functionally with other inner membrane proteins involved in stress response?

YgiZ shares functional similarities and differences with other inner membrane proteins involved in stress response:

  • Comparison with YhiM:

    • Both YgiZ and YhiM are inner membrane proteins involved in stress response pathways

    • YhiM links copper homeostasis with the CpxAR envelope stress response system, while YgiZ appears more specifically involved in calcium-mediated stress response

    • YhiM deletion leads to lower intracellular copper accumulation, while YgiZ deletion appears to primarily affect calcium-mediated transformation

    • Both proteins influence bacterial fitness, with YhiM shown to be required for optimal fitness of UPEC in mouse UTI models

  • Comparison with YiaW:

    • Both YgiZ and YiaW were identified in the same study as key genes in calcium-mediated transformation

    • Deletion of either gene enhances transformation efficiency, though YgiZ deletion shows a stronger effect (2.12-fold versus 1.58-fold increase for pET-32a plasmid)

    • Both gene deletions affect membrane permeability, though the precise mechanisms may differ

    • Unlike YgiZ, YiaW deletion does not significantly alter bacterial morphology

  • Comparison with OsmB:

    • Both proteins were identified among the 15 key genes involved in cellular response to calcium

    • OsmB deletion, like YgiZ deletion, enhances transformation efficiency, though with different magnitudes depending on plasmid size

    • OsmB is traditionally associated with osmotic stress response, suggesting more specialized function compared to YgiZ

  • Functional Categorization:

    • YgiZ appears to be more strongly associated with calcium-specific responses and transformation efficiency

    • Other membrane proteins may have more diverse roles in various stress responses

    • The functional overlap suggests potential redundancy or complementary roles in stress response networks

This comparative analysis highlights YgiZ as part of a broader network of inner membrane proteins that collectively regulate bacterial responses to environmental stressors, with potentially specialized roles in calcium-mediated processes.

What evolutionary insights can be gained from studying YgiZ conservation across bacterial species?

Evolutionary analysis of YgiZ conservation across bacterial species provides valuable insights into its functional importance and adaptation:

  • Phylogenetic Distribution:

    • Examination of YgiZ homologs across bacterial phyla would reveal its evolutionary history

    • Core vs. accessory genome classification would indicate whether YgiZ represents an essential or specialized function

    • Co-evolution patterns with other genes could identify functional partners conserved across species

  • Structural Conservation Analysis:

    • Identification of highly conserved domains or residues suggests functionally critical regions

    • Variable regions might indicate species-specific adaptations or substrate specificities

    • Transmembrane topology conservation analysis could reveal structural constraints

  • Selection Pressure Analysis:

    • Calculation of Ka/Ks ratios to determine whether YgiZ is under purifying, neutral, or positive selection

    • Identification of rapidly evolving sites that might confer species-specific functions

    • Comparison of selection patterns between pathogenic and non-pathogenic species

  • Horizontal Gene Transfer Assessment:

    • Analysis of genomic context across species to identify potential horizontal gene transfer events

    • Examination of GC content and codon usage bias to detect recent acquisition events

    • Correlation with mobile genetic elements in different species

  • Functional Divergence Patterns:

    • Identification of paralogous genes that may have arisen through duplication events

    • Functional characterization of YgiZ homologs in diverse bacterial species

    • Correlation of genetic variants with phenotypic differences across species

While the available search results do not provide specific evolutionary analyses of YgiZ, the approaches outlined above would generate valuable insights into how this protein has been maintained or adapted throughout bacterial evolution, potentially revealing new functional aspects not apparent from single-species studies.

What optimized protocols exist for studying YgiZ in different experimental contexts?

Several optimized protocols have been developed for studying YgiZ across various experimental contexts:

  • Gene Deletion and Mutant Construction:

    • Red homologous recombination protocol:

      • Use of plasmid pKD4 as template for PCR amplification of targeting fragments

      • Primer design to create 1,766 bp FRT-kan-FRT targeting fragments

      • Transformation into E. coli DH5α/pKD46 cells

      • Selection on kanamycin plates and verification by PCR and sequencing

  • Transformation Efficiency Assessment:

    • Standardized protocol using 100 mM CaCl₂ treatment

    • Testing multiple plasmid sizes (pUC19, pET-32a, p1304)

    • Calculation of transformation efficiency using the formula:
      TE=D×C×TvB×vQTE = \frac{D \times C \times T}{v_B \times v_Q}

    • Inclusion of appropriate negative controls (aseptic water treatment)

  • Growth and Morphological Analysis:

    • Growth curve determination:

      • Addition of 1 mL overnight culture to 99 mL fresh LB medium

      • Incubation at 37°C with shaking at 180 rpm

      • OD₆₀₀ measurement at regular intervals (0, 2, 4, ..., 24, 35, 40, 45, 50, 55, 60 h)

    • Morphological assessment through microscopy with length/width ratio calculation

  • Membrane Permeability Assessment:

    • Flow cytometry analysis following CaCl₂ treatment

    • Comparison of positive cell ratios between wild-type and mutant strains

  • Expression Analysis:

    • qRT-PCR verification using the ΔΔCт algorithm

    • Transcriptome analysis to identify differentially expressed genes

    • Proteome analysis to detect protein-level changes

These protocols have been successfully implemented in research settings to characterize YgiZ function, particularly in the context of calcium-mediated transformation. They provide a robust methodological framework that can be adapted to diverse research questions related to YgiZ and its role in bacterial physiology.

How can YgiZ research findings be applied to improve recombinant protein production in E. coli?

YgiZ research findings offer several promising applications for improving recombinant protein production in E. coli:

  • Enhanced Transformation Systems:

    • Development of ΔygiZ E. coli strains as superior hosts for recombinant plasmid transformation

    • Creation of transformation protocols utilizing the 1.68-2.12 fold efficiency enhancement observed in ΔygiZ strains

    • Optimization for large plasmids, which typically have lower transformation efficiencies

  • Improved Membrane Protein Expression:

    • Utilization of ΔygiZ strains with altered membrane permeability characteristics for membrane protein production

    • Development of calcium concentration optimization strategies based on YgiZ research

    • Engineering of strains with fine-tuned YgiZ expression levels for different classes of membrane proteins

  • Stress-Resistant Production Strains:

    • Application of insights from stress response pathways involving YgiZ to create more robust production hosts

    • Engineering of strains with modified YgiZ function to better withstand high-density fermentation conditions

    • Development of calcium-responsive expression systems based on YgiZ-regulated pathways

  • Process Optimization Strategies:

    • Implementation of calcium treatment regimens informed by YgiZ research to enhance protein production

    • Utilization of altered morphology in ΔygiZ strains (4.32 length/width ratio) for potential improvements in protein folding or secretion

    • Optimization of medium composition based on YgiZ-related calcium response pathways

  • Scale-up Considerations:

    • Development of bioprocess parameters specifically optimized for ΔygiZ production strains

    • Implementation of monitoring systems for calcium levels during fermentation

    • Creation of inducible YgiZ expression systems for temporal control during production processes

These applications leverage the fundamental research findings on YgiZ function, particularly its role in calcium-mediated transformation and membrane permeability, to address practical challenges in recombinant protein production and potentially improve yields, quality, and consistency of bioprocesses.

What are the key challenges and limitations in current YgiZ research methodologies?

Current YgiZ research methodologies face several significant challenges and limitations:

  • Genetic Manipulation Constraints:

    • Potential polar effects on adjacent genes when creating deletion mutants

    • Challenges in achieving partial knockdowns or controlled expression levels

    • Difficulties in engineering site-specific mutations in membrane proteins

    • Limited tools for temporal control of YgiZ expression

  • Structural Analysis Limitations:

    • Technical challenges in membrane protein crystallization or structure determination

    • Difficulties in capturing dynamic conformational changes in response to calcium

    • Limited understanding of YgiZ topology and membrane integration

    • Computational modeling challenges due to limited structural homologs

  • Functional Characterization Obstacles:

    • Indirect measurement of YgiZ activity through transformation efficiency rather than direct biochemical assays

    • Difficulties distinguishing primary from secondary effects in global transcriptomic/proteomic analyses

    • Challenges in real-time monitoring of YgiZ function in living cells

    • Limited understanding of potential ligands or interaction partners

  • Physiological Relevance Questions:

    • Most studies conducted in laboratory strains under artificial conditions (e.g., 100 mM CaCl₂)

    • Limited in vivo validation of findings in relevant environmental or host contexts

    • Unclear relationship between laboratory phenotypes and ecological functions

    • Potential strain-specific variations in YgiZ function not fully characterized

  • Technical Measurement Challenges:

    • Variability in transformation efficiency assays requiring extensive replication

    • Difficulty quantifying membrane protein expression levels accurately

    • Limited sensitivity in detecting subtle phenotypic changes

    • Challenges in separating YgiZ-specific effects from general membrane perturbations

Addressing these limitations would require development of new methodological approaches, including more precise genetic tools, improved structural analysis techniques for membrane proteins, direct biochemical assays for YgiZ function, and more physiologically relevant experimental systems. Future research should aim to overcome these challenges to build a more comprehensive understanding of YgiZ biology.

What are the most significant unanswered questions about YgiZ function in E. coli?

Despite considerable progress in understanding YgiZ, several critical questions remain unanswered:

  • Molecular Mechanism Questions:

    • Does YgiZ directly interact with calcium ions, and if so, what is the binding mechanism?

    • What is the precise molecular pathway through which YgiZ influences transformation efficiency?

    • How does YgiZ structurally respond to calcium and other environmental signals?

    • What is the complete interactome of YgiZ in different cellular conditions?

  • Regulatory Network Questions:

    • What transcription factors and regulatory elements control ygiZ expression?

    • How is YgiZ activity post-translationally regulated?

    • How does YgiZ integrate into broader stress response networks?

    • What feedback mechanisms exist to modulate YgiZ function?

  • Physiological Role Questions:

    • What is the primary evolutionary function of YgiZ beyond laboratory transformation contexts?

    • How does YgiZ contribute to bacterial fitness in natural environments?

    • What role does YgiZ play in bacterial adaptation to host environments?

    • How does YgiZ function change across different growth phases and stress conditions?

  • Structural Biology Questions:

    • What is the three-dimensional structure of YgiZ?

    • How does YgiZ orientation in the membrane relate to its function?

    • What conformational changes occur in response to calcium binding?

    • Which domains or residues are critical for YgiZ function?

  • Applied Research Questions:

    • Can YgiZ manipulation be leveraged for improved biotechnological applications?

    • Might YgiZ or related proteins serve as targets for novel antimicrobial approaches?

    • How can YgiZ research inform our understanding of horizontal gene transfer in bacterial communities?

Addressing these questions will require interdisciplinary approaches combining molecular genetics, structural biology, systems biology, and ecological studies. Current research has established YgiZ as a key player in calcium-mediated transformation , but a comprehensive understanding of its full biological significance remains to be developed.

How might advances in biotechnology and genetic engineering impact future YgiZ research?

Emerging biotechnological and genetic engineering advances will likely transform YgiZ research in several key ways:

  • CRISPR-Cas Technology Applications:

    • Precise genome editing for creating point mutations in ygiZ rather than complete deletions

    • CRISPRi approaches for tunable repression of ygiZ expression

    • CRISPR-based screening to identify genetic interactions with ygiZ

    • Base editing for introducing specific amino acid changes without double-strand breaks

  • Single-Cell Analysis Techniques:

    • Single-cell RNA-seq to reveal cell-to-cell variability in ygiZ expression

    • Microfluidic platforms for tracking transformation events at the single-cell level

    • Time-lapse microscopy combined with fluorescent reporters to monitor YgiZ dynamics

    • Mass cytometry for multiplexed protein measurements in YgiZ-related pathways

  • Synthetic Biology Approaches:

    • Creation of synthetic ygiZ variants with enhanced or modified functions

    • Development of genetic circuits incorporating YgiZ as a calcium-responsive element

    • Minimal cell platforms to study YgiZ function in simplified genetic backgrounds

    • Cell-free expression systems for studying YgiZ biochemistry without cellular complexity

  • Advanced Imaging Technologies:

    • Cryo-electron tomography for visualizing YgiZ in its native membrane environment

    • Super-resolution microscopy to track YgiZ localization and dynamics

    • Label-free imaging techniques to observe bacterial transformation in real-time

    • Correlative microscopy to connect molecular and cellular phenotypes

  • Computational and AI-Driven Approaches:

    • Machine learning for predicting YgiZ function from sequence and structural features

    • Network analysis algorithms to position YgiZ within global regulatory networks

    • Molecular dynamics simulations with improved membrane protein parameters

    • Automated high-throughput experimental design and analysis pipelines

These technological advances will enable researchers to address current limitations in YgiZ research, potentially revealing new functions, regulatory mechanisms, and applications. The combination of precise genetic control, single-molecule resolution measurements, and computational modeling will provide unprecedented insights into the structure-function relationships of YgiZ and its role in bacterial physiology.

Table 1: Transformation Efficiency Comparison Between Wild-Type and ΔygiZ Strains

PlasmidSize (bp)Wild-Type E. coli DH5α (CFU/μg)ΔygiZ Strain (CFU/μg)Fold IncreaseP-value
pUC192,686Baseline1.68× higher1.68<0.001
pET-32a5,900Baseline2.12× higher2.12<0.001
p1304>10,000Baseline1.37× higher1.37<0.001

Data derived from research showing the impact of ygiZ deletion on transformation efficiency across plasmids of different sizes .

Table 2: Morphological and Membrane Permeability Characteristics

StrainLength/Width RatioPositive Cell Ratio After CaCl₂ (%)Relative Increase (%)
Wild-type E. coli DH5α2.64Baseline-
ΔygiZ4.32Baseline + 3%3.0
ΔyiaW2.54Baseline + 7%7.0
ΔosmB2.30Baseline + 6.9%6.9

Comparative analysis of morphological characteristics and membrane permeability changes in gene deletion strains as measured by flow cytometry following 100 mM CaCl₂ treatment .

Table 3: Gene Expression Changes in Response to Calcium Treatment

Gene CategoryNumber of Upregulated GenesNumber of Downregulated GenesMajor Functional Categories
All Genes31716Cell membrane components, transmembrane transport, stress response
Proteins5491Cell membrane components, transmembrane transport, stress response
Key Genes15 (including ygiZ, yiaW, osmB)Not specifiedCellular response to Ca²⁺

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.