Recombinant Escherichia coli Inner membrane protein yhaH (yhaH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
yhaH; b3103; JW3074; Inner membrane protein YhaH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yhaH
Target Protein Sequence
MDWYLKVLKNYVGFRGRARRKEYWMFILVNIIFTFVLGLLDKMLGWQRAGGEGILTTIYG ILVFLPWWAVQFRRLHDTDRSAWWALLFLIPFIGWLIIIVFNCQAGTPGENRFGPDPKLE P
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted structural organization of yhaH in E. coli membranes?

Based on comparative analysis with other E. coli inner membrane proteins, yhaH likely possesses at least one transmembrane domain anchoring it to the inner membrane. Similar to YqjD, which has a transmembrane motif in the C-terminal region, yhaH may have domains extending into either the cytoplasm or periplasm . Structural prediction tools suggest a predominantly alpha-helical topology common to many bacterial membrane proteins. When designing experiments to study yhaH localization, subcellular fractionation techniques used for proteins like YqjD can be applied, where membrane, cytoplasmic, and ribosomal fractions are separated by ultracentrifugation .

How can I confirm the membrane localization of recombinant yhaH?

To verify yhaH's localization to the inner membrane, employ a multi-step fractionation protocol:

  • Harvest cells expressing recombinant yhaH and lyse using French pressure cell or sonication

  • Separate cell debris by low-speed centrifugation (10,000×g for 10 minutes)

  • Subject the supernatant to ultracentrifugation (100,000×g for 1 hour) to isolate membrane fractions

  • Analyze both the membrane pellet and supernatant fractions by SDS-PAGE and Western blotting

This approach was successfully used for YqjD, demonstrating its absence in the post-ribosomal supernatant fraction and confirming its membrane association . Additionally, create fluorescent protein fusions (e.g., GFP-yhaH) to visualize localization using fluorescence microscopy as a complementary technique.

What expression systems are suitable for recombinant yhaH production?

For laboratory-scale expression of recombinant yhaH, E. coli remains the preferred heterologous system due to:

  • Rapid growth and high cell density potential

  • Native environment for proper folding of E. coli membrane proteins

  • Availability of specialized strains optimized for membrane protein expression

When expressing yhaH, consider using E. coli strains with reduced protease activity (BL21, C41, C43) that are specifically designed for membrane protein expression. Based on studies with other recombinant proteins, a tiered approach starting with BL21(DE3) and progressing to specialized strains like C41(DE3) if inclusion bodies form is recommended . The expression vector should include a fusion tag (His6, MBP, or SUMO) to facilitate purification while potentially enhancing solubility.

How might yhaH contribute to stress response mechanisms in E. coli?

Several E. coli inner membrane proteins participate in stress response pathways. For instance, YqjD expression is regulated by the stationary phase sigma factor RpoS and increases during transition from exponential to stationary phase . YhiM functions in copper homeostasis by interacting with the CpxAR envelope stress response system .

To investigate yhaH's potential role in stress responses:

  • Create a yhaH deletion mutant using CRISPR-Cas9 or lambda Red recombination

  • Subject wild-type and ΔyhaH strains to various stressors (osmotic, oxidative, acid, heat shock)

  • Compare growth rates, survival, and gene expression profiles using RNA-seq

  • Examine potential synthetic lethal relationships with other stress response genes

A particularly informative approach would be to test for synthetic lethality, as observed between YhcB and RodZ . This involves creating double deletion mutants (ΔyhaH with deletions of other stress response genes) to identify functional relationships and potential redundancies in stress response pathways.

What techniques can identify proteins that interact with yhaH?

To elucidate the protein interaction network of yhaH, apply these complementary approaches:

Bacterial Two-Hybrid (BACTH) System:
The BACTH system, successfully used to identify YhcB interactions with RodZ , is particularly effective for membrane proteins. This approach requires:

  • Construction of yhaH fusions with adenylate cyclase fragments (T18 and T25)

  • Co-expression in a ΔcyaA strain followed by screening on indicator plates

  • Confirmation of positive interactions using β-galactosidase assays

When designing these constructs, careful consideration of yhaH topology is essential. Based on studies with YhcB, if yhaH has a single transmembrane domain, fusion proteins should be designed with the cyclase fragments attached to the cytoplasmic portion .

Co-Immunoprecipitation with Crosslinking:
For in vivo validation of interactions:

  • Express epitope-tagged yhaH in E. coli

  • Crosslink proteins using membrane-permeable agents (DSP or formaldehyde)

  • Solubilize membranes with mild detergents (DDM or CHAPS)

  • Immunoprecipitate with anti-tag antibodies

  • Identify co-precipitating proteins using mass spectrometry

This approach can identify both stable and transient interactions occurring in the native membrane environment.

How can I investigate whether yhaH interacts with ribosomes like other inner membrane proteins?

Some E. coli inner membrane proteins, such as YqjD, associate with ribosomes . To determine if yhaH similarly interacts with ribosomes:

  • Isolate 70S and 100S ribosomes by sucrose density gradient centrifugation

  • Analyze ribosomal fractions for the presence of yhaH by Western blotting

  • Compare ribosome profiles between wild-type and ΔyhaH strains

  • Examine ribosome distribution between membrane and cytosolic fractions

If yhaH associates with ribosomes, its role may be analogous to YqjD, which has been suggested to localize ribosomes to the membrane during stationary phase . Additionally, consider how yhaH expression changes throughout growth phases, as YqjD expression reaches maximum levels after 2 days in stationary phase .

How can I determine if yhaH plays a role in cell envelope maintenance?

The E. coli inner membrane protein YhcB interacts with RodZ and is involved in cell shape maintenance . To investigate whether yhaH may have similar functions:

  • Generate a ΔyhaH strain and characterize its morphology using phase contrast and electron microscopy

  • Test sensitivity to cell wall-targeting antibiotics (β-lactams, vancomycin)

  • Examine synthetic phenotypes with deletions in genes involved in cell envelope biogenesis

  • Analyze peptidoglycan composition in wild-type versus ΔyhaH strains

A particularly informative experiment would be testing for synthetic lethality between yhaH and other genes involved in cell envelope maintenance, as observed with yhcB and rodZ . If deleting both genes produces a lethal phenotype or severe growth defect, this would suggest functional interaction or redundancy.

What approaches can distinguish between direct and indirect effects of yhaH deletion?

When analyzing phenotypes of a ΔyhaH strain, distinguishing direct from indirect effects requires:

  • Complementation studies: Transform the ΔyhaH strain with plasmid-expressed yhaH under control of an inducible promoter to confirm phenotype reversal

  • Point mutation analysis: Generate specific mutations in key domains to correlate structural features with function

  • Temporal expression control: Use tightly regulated induction systems to determine immediate versus long-term effects of yhaH depletion

  • Multi-omics analysis: Combine transcriptomics, proteomics, and metabolomics to build a comprehensive picture of cellular changes

This multi-faceted approach helps establish causal relationships between yhaH and observed phenotypes rather than correlative associations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.