Recombinant Escherichia coli Inner membrane protein yhaI (yhaI)

Shipped with Ice Packs
In Stock

Description

Expression Systems

Recombinant YhaI is produced in E. coli using plasmids with strong promoters (e.g., T7 or lacUV5) and affinity tags for purification. Key parameters include:

ParameterSpecification
Host StrainE. coli K12 derivatives (e.g., BL21(DE3))
VectorpET21d(+) or similar, with N-terminal His-tag
InductionIPTG (0.1–1.0 mM)
Purity>90% (verified by SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0) at -80°C
Source:

Challenges in Production

  • Solubility Issues: YhaI’s hydrophobic transmembrane domains often lead to inclusion body formation. Strategies like codon optimization, low-temperature induction (18–25°C), and detergent supplementation (e.g., 1–15 mM DTT) improve solubility .

  • Toxicity: Overexpression can impair proton motive force, activating stress pathways (e.g., Psp) .

Role in Envelope Stress Response

YhaI interacts with the Rcs phosphorelay system, which monitors envelope integrity. Key findings:

  • Stress Activation: YhaI overexpression induces Rcs and Psp pathways, suggesting cross-regulation during membrane stress .

  • Pathway Crosstalk: Simultaneous activation of Bae, Cpx, Rcs, and σE pathways occurs during envelope damage, but YhaI-associated responses show minimal overlap with other systems .

Applications in Research

ApplicationUtility
Antibiotic ResistanceStudying Rcs-mediated resistance mechanisms in Gram-negative pathogens
Membrane Protein StudiesTemplate for optimizing hydrophobic protein expression
Stress Response ModelsProbing envelope stress signaling in E. coli and related species
Source:

Future Directions

  1. Mechanistic Studies: Elucidate YhaI’s role in Rcs phosphorelay signal transduction using cryo-EM .

  2. Biotechnological Optimization: Develop E. coli strains with reduced metabolic burden for high-yield YhaI production .

  3. Therapeutic Exploration: Investigate YhaI as a target for disrupting bacterial envelope integrity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
yhaI; b3104; JW3075; Inner membrane protein YhaI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yhaI
Target Protein Sequence
MQWYLSVLKNYVGFSGRARRKEYWMFTLINAIVGAIINVIQLILGLELPYLSMLYLLATF LPVLALAIRRLHDTDRSGAWALLFFVPFIGWLVLLVFFCTEGTSGSNRYGNDPKFGSN
Uniprot No.

Target Background

Database Links

KEGG: ecj:JW3075

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How should researchers properly store and reconstitute recombinant yhaI protein?

Recombinant yhaI protein is typically supplied as a lyophilized powder. For optimal results:

  • Storage conditions: Store unopened vials at -20°C/-80°C upon receipt

  • Preparation for use: Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitution protocol: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Stability considerations: Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C

  • Working conditions: Store working aliquots at 4°C for up to one week

  • Important note: Avoid repeated freeze-thaw cycles as they can compromise protein integrity

What expression systems are most effective for producing recombinant yhaI protein?

For successful expression of yhaI:

  • Host system: E. coli is the preferred expression host for recombinant yhaI protein production

  • Tags: An N-terminal His-tag has been successfully used for purification without apparent interference with protein folding

  • Buffer conditions: Tris/PBS-based buffer with 6% Trehalose at pH 8.0 has been shown to maintain stability

  • Purity assessment: SDS-PAGE analysis should confirm purity greater than 90%

The choice of expression system is particularly important for membrane proteins like yhaI, as they require proper membrane insertion machinery for correct folding.

What methodological approaches are most effective for studying the transmembrane topology of yhaI?

Several complementary approaches can be employed to characterize the transmembrane topology of yhaI:

  • Computational prediction: Use algorithms such as TMHMM, HMMTOP, or TOPCONS to predict transmembrane domains based on the amino acid sequence

  • Cysteine scanning mutagenesis: Systematically replace residues with cysteine and assess accessibility to membrane-impermeable sulfhydryl reagents

  • PhoA/LacZ fusion analysis: Create fusions at different positions to determine cytoplasmic vs. periplasmic localization

  • Protease protection assays: Use proteases that cannot cross membranes to identify exposed regions

  • Cryo-EM or X-ray crystallography: For high-resolution structural determination, though these are technically challenging for membrane proteins

When designing experiments, consider that membranous extraction procedures must preserve the native conformation of the protein to yield meaningful results.

How might yhaI function be related to the copper homeostasis network in E. coli?

Based on studies of related inner membrane proteins, yhaI may play a role in copper homeostasis:

  • Comparative analysis: The related inner membrane protein YhiM has been shown to play a critical role in copper homeostasis in uropathogenic E. coli (UPEC)

  • Potential mechanism: YhiM appears to link copper stress with the CpxAR-dependent envelope stress response system

  • Structural considerations: The N-terminal MXXXM motif (where X is typically a hydrophobic amino acid) found in copper transporters may be functionally significant in related proteins

  • Experimental approach: Copper sensitivity assays comparing wild-type and ΔyhaI mutants would be informative

  • Gene regulation studies: qRT-PCR or reporter gene assays to measure expression changes in response to copper stress

Researchers should consider designing experiments that measure intracellular copper levels in wild-type versus ΔyhaI mutant strains to determine if yhaI affects copper transport or homeostasis.

What are the challenges and solutions for purifying functional yhaI for biochemical studies?

Membrane protein purification presents specific challenges:

  • Solubilization strategy:

    • Test different detergents (DDM, LDAO, Triton X-100)

    • Screen detergent-to-protein ratios

    • Consider native nanodiscs or amphipols for maintaining stability

  • Purification protocol:

    • Use immobilized metal affinity chromatography (IMAC) for His-tagged yhaI

    • Follow with size exclusion chromatography to remove aggregates

    • Monitor protein quality by dynamic light scattering

  • Functionality assessment:

    • Circular dichroism to confirm secondary structure

    • Fluorescence-based ligand binding assays

    • Reconstitution into liposomes for transport studies

  • Common pitfalls:

    • Membrane proteins often form inclusion bodies

    • Detergent micelles may interfere with downstream applications

    • Loss of function during purification

A systematic approach testing multiple conditions is recommended, as membrane protein purification conditions must be empirically determined for each protein.

How can macrodomain organization of the E. coli chromosome affect yhaI expression studies?

When studying yhaI expression, researchers should consider chromosomal context:

  • Macrodomain considerations: The E. coli chromosome is organized into four macrodomains and two less-structured regions that can affect gene expression

  • Integration site selection: For chromosomal integration of reporter constructs, consider that DNA interactions are restricted within chromosome subregions

  • Sister chromatid effects: Interactions between sister chromatids are rare, suggesting chromosome segregation quickly follows replication

  • Experimental design: When creating genetic constructs to study yhaI, the insertion location may affect expression due to these structural constraints

  • Controls: Include multiple insertion sites when possible to account for positional effects

This macrodomain organization may influence experimental outcomes when manipulating yhaI genetic context or studying its regulation.

What techniques are most effective for studying protein-protein interactions involving yhaI?

To investigate potential interaction partners of yhaI:

  • Membrane-specific crosslinking:

    • In vivo photo-crosslinking with unnatural amino acids

    • Chemical crosslinkers with varying spacer lengths

    • Analysis by mass spectrometry to identify crosslinked partners

  • Bacterial two-hybrid systems:

    • BACTH (Bacterial Adenylate Cyclase Two-Hybrid) system adapted for membrane proteins

    • Split-ubiquitin assays modified for bacterial use

  • Co-immunoprecipitation approaches:

    • Gentle solubilization to maintain protein-protein interactions

    • Antibodies against the His-tag or specific anti-yhaI antibodies

    • Mass spectrometry identification of co-precipitated proteins

  • Proteomic analysis:

    • Quantitative proteomics comparing wild-type and ΔyhaI strains

    • Membrane proteome fractionation to enrich for potential partners

  • Functional genomics screening:

    • Synthetic genetic array analysis to identify genetic interactions

    • Suppressor screens to identify functional relationships

Given the potential relationship between yhaI and stress response systems, interactions with envelope stress sensors would be particularly interesting to investigate.

How should researchers design control experiments when studying yhaI function?

Rigorous control experiments are essential:

  • Genetic complementation: Always verify phenotypes by complementing gene deletions with plasmid-expressed yhaI

  • Empty vector controls: Include empty vector controls when using plasmid-based expression

  • Tag interference: Compare tagged and untagged versions to ensure tags don't interfere with function

  • Growth conditions: Test multiple growth conditions as membrane protein function may be condition-dependent

  • Strain background considerations: Verify results in multiple E. coli strain backgrounds as phenotypes may vary

Particularly important is ensuring that any observed phenotypes in yhaI mutants are specifically due to loss of yhaI function rather than polar effects on neighboring genes.

What are the best approaches for studying yhaI expression regulation?

To investigate how yhaI expression is regulated:

  • Transcriptional fusions:

    • Create transcriptional fusions of the yhaI promoter with reporter genes (GFP, lacZ)

    • Test expression under various stress conditions (pH, copper, envelope stress)

  • Transcription start site mapping:

    • Use 5' RACE or primer extension to identify transcription start sites

    • RNA-seq to identify operon structure and co-regulated genes

  • Chromatin immunoprecipitation (ChIP):

    • Identify transcription factors binding to the yhaI promoter

    • Focus on potential regulators like CpxR based on potential stress response connections

  • Single-cell analysis:

    • Microfluidics combined with fluorescent reporters to detect expression heterogeneity

    • Time-lapse microscopy to track expression dynamics

These approaches would help determine if yhaI is regulated as part of stress response pathways similar to related membrane proteins.

How should researchers address data inconsistencies when studying yhaI across different E. coli strains?

When confronting strain-specific differences:

  • Sequence comparison: Complete sequence analysis of yhaI and regulatory regions across strains

  • Genetic background effects: Consider strain-specific genetic modifiers by complementation experiments

  • Environmental sensitivity: Test whether strain differences are amplified under specific conditions

  • Statistical approach: Apply appropriate statistical methods to quantify variation between strains

  • Evolutionary context: Consider phylogenetic relationships between strains showing different phenotypes

For example, differences in copper resistance between strains may depend on the presence of specific protein motifs, as observed with the MXXXM motif in YhiM that affects copper resistance in uropathogenic but not commensal E. coli strains .

What bioinformatic approaches can reveal potential functions of yhaI?

Computational analyses can provide functional insights:

  • Structural prediction:

    • AlphaFold or RoseTTAFold for 3D structure prediction

    • Comparison to known membrane protein structures

  • Comparative genomics:

    • Synteny analysis across bacterial species

    • Co-occurrence patterns with functionally related genes

  • Protein domain analysis:

    • Identification of conserved domains and motifs

    • Detection of potential metal-binding sites

  • Phylogenetic profiling:

    • Correlation of presence/absence with specific bacterial phenotypes

    • Evolutionary rate analysis to detect selective pressure

  • Integration with transcriptomic data:

    • Co-expression network analysis

    • Identification of conditions where yhaI is differentially expressed

These computational approaches can generate testable hypotheses about yhaI function that can guide experimental design.

How might yhaI contribute to bacterial stress responses beyond copper homeostasis?

Based on knowledge of related membrane proteins:

  • pH adaptation: Test growth of yhaI mutants under various pH conditions, as related proteins have been implicated in acid resistance

  • Membrane integrity: Measure membrane permeability using fluorescent dyes in wild-type vs. mutant strains

  • Envelope stress: Investigate activation of envelope stress response pathways (Cpx, σE) in yhaI mutants

  • Oxidative stress: Determine sensitivity to reactive oxygen species, which often accompanies metal stress

  • Antibiotic resistance: Test susceptibility to antibiotics targeting the cell envelope

Design experiments that measure multiple stress parameters simultaneously, as membrane proteins often function at the intersection of multiple stress response pathways.

What methodological approaches can resolve the subcellular localization and dynamics of yhaI?

To determine precise localization:

  • Super-resolution microscopy:

    • PALM/STORM imaging of fluorescently tagged yhaI

    • Structured illumination microscopy to visualize membrane distribution

  • Fractionation techniques:

    • Sucrose gradient ultracentrifugation to separate inner and outer membranes

    • Free-flow electrophoresis for membrane domain separation

  • Dynamic studies:

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

    • Single-particle tracking of labeled yhaI proteins

  • Co-localization analysis:

    • Multi-color imaging with markers for different membrane domains

    • Statistical analysis of spatial correlation with known membrane proteins

  • Electron microscopy:

    • Immuno-gold labeling combined with electron microscopy

    • Cryo-electron tomography for 3D visualization

These approaches can reveal not only where yhaI localizes but also how its distribution changes under different conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.