Recombinant Escherichia coli Inner membrane protein yhhQ (yhhQ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Queuosine Biosynthesis

YhhQ belongs to the COG1738 family and functions as a 7-deazapurine transporter, essential for salvaging preQ₀ (7-cyano-7-deazaguanine) and preQ₁ (7-aminomethyl-7-deazaguanine) . Key findings include:

  • Substrate Specificity: PreQ₀ is preferentially imported over preQ₁ in E. coli, as shown by tRNA modification assays in ΔqueD strains .

  • Genetic Complementation: Expression of yhhQ in ΔqueD ΔyhhQ mutants restored Q biosynthesis, confirming its transport role .

  • Evolutionary Conservation: Sequence similarity network (SSN) analyses reveal YhhQ subgroups specialized for preQ₀, preQ₁, or queuine transport across bacterial species .

Experimental Validation of Transport Activity

Indirect assays using tRNA analysis demonstrated YhhQ’s necessity for precursor uptake:

ExperimentStrainResultReference
PreQ₀ Salvage AssayΔqueDQ detected in tRNA with 10 nM preQ₀
PreQ₁ Salvage AssayΔqueDWeak Q signal with 10 nM preQ₁
ΔyhhQ ComplementationΔqueD ΔyhhQ + pBAD::yhhQRestored Q biosynthesis

These studies confirmed that YhhQ is indispensable for precursor uptake but requires ancillary proteins for full transport activity .

Biotechnological Applications

Recombinant yhhQ is commercially available for research on bacterial metabolism and antibiotic targeting:

  • Supplier Pricing: Ranges from $845 (MyBioSource) to CA$1,693.44 (GeneBio Systems) .

  • Antibody Development: Rabbit polyclonal antibodies against yhhQ enable Western blot and ELISA applications .

  • Structural Studies: Full-length recombinant protein facilitates membrane protein crystallization efforts .

Open Questions and Future Directions

  • Transport Mechanism: Whether YhhQ operates as a solo transporter or requires partner proteins remains unresolved .

  • Substrate Determinants: Residues governing preQ₀/preQ₁ specificity are unidentified, necessitating structural studies .

  • Pathogen Targeting: YhhQ homologs in Chlamydia trachomatis and Clostridioides difficile suggest potential for queuosine-pathway inhibitors .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yhhQ; b3471; JW3436; Queuosine precursor transporter; Q precursor transporter
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yhhQ
Target Protein Sequence
MNVFSQTQRYKALFWLSLFHLLVITSSNYLVQLPVSILGFHTTWGAFSFPFIFLATDLTV RIFGAPLARRIIFAVMIPALLISYVISSLFYMGSWQGFGALAHFNLFVARIATASFMAYA LGQILDVHVFNRLRQSRRWWLAPTASTLFGNVSDTLAFFFIAFWRSPDAFMAEHWMEIAL VDYCFKVLISIVFFLPMYGVLLNMLLKRLADKSEINALQAS
Uniprot No.

Target Background

Function
This protein is involved in the import of queuosine (Q) precursors, which are essential for Q precursor salvage. It transports 7-cyano-7-deazaguanine (preQ(0)) and 7-aminomethyl-7-deazaguanine (preQ(1)), exhibiting a preference for preQ(0).
Database Links
Protein Families
Vitamin uptake transporter (VUT/ECF) (TC 2.A.88) family, Q precursor transporter subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of YhhQ in Escherichia coli?

YhhQ is primarily involved in the transport of queuosine (Q) precursors in E. coli. Specifically, it facilitates the import of preQ₀ and preQ₁, which are essential intermediates in the queuosine modification pathway of tRNAs. This transport activity was demonstrated through in vivo salvage experiments, where YhhQ was shown to be necessary for the uptake of these precursors from the external environment. E. coli strains with intact YhhQ could salvage external preQ₀ and preQ₁ for incorporation into tRNAs, while ΔyhhQ strains were unable to utilize these precursors efficiently .

How is YhhQ related to the queuosine modification pathway?

YhhQ functions within the broader context of queuosine biosynthesis and salvage in E. coli. The queuosine modification occurs in tRNAs with GUN anticodons (tRNA^Asp, tRNA^Asn, tRNA^His, and tRNA^Tyr) and enhances translational efficiency and accuracy. The pathway involves:

  • De novo synthesis: Organisms like E. coli can synthesize Q from GTP through multiple enzymatic steps

  • Salvage pathway: Alternatively, cells can import Q precursors (preQ₀, preQ₁) from the environment

  • YhhQ's role: Acts as the membrane transporter that facilitates the uptake of these precursors

The presence of YhhQ in organisms with complete de novo synthesis capabilities (like E. coli) suggests that salvage is more economical than de novo synthesis when precursors are available in the environment .

How is the yhhQ gene regulated in bacteria?

The yhhQ gene is subject to several regulatory mechanisms:

  • Riboswitch control: In various bacteria, yhhQ is regulated by preQ₁ riboswitches

  • Co-regulation with Q-related genes: yhhQ is often found in genomic proximity to other genes involved in queuosine metabolism

  • Purine regulon membership: YhhQ is reported to be a member of the purine regulon (PurR) in E. coli

  • Metal response: In Erwinia amylovora, both yhhQ and queE (ygcF) are upregulated in response to copper, reinforcing the connection between YhhQ and the queuosine pathway

This multi-layered regulation suggests the importance of coordinating YhhQ expression with both purine metabolism and Q modification pathways .

What genetic approaches can be used to study YhhQ function in E. coli?

To investigate YhhQ function in E. coli, researchers can employ several genetic strategies:

  • Gene deletion: Create ΔyhhQ strains using standard gene knockout techniques

  • Complementation studies: Transform ΔyhhQ strains with plasmids containing the yhhQ gene to verify function

  • Double-knockout approach: Generate strains deficient in both de novo synthesis (e.g., ΔqueD) and yhhQ (ΔqueD ΔyhhQ) to isolate salvage pathway effects

  • Control vectors: Include empty vector controls when performing complementation experiments

  • Inducible expression systems: Use plasmids with inducible promoters (like pBAD24) to control YhhQ expression levels

In published research, this approach successfully demonstrated YhhQ's role in Q precursor transport by showing that complementation with plasmid-borne yhhQ restored the salvage capability in ΔqueD ΔyhhQ strains .

How can YhhQ protein be effectively expressed and purified for biochemical studies?

For optimal expression and purification of YhhQ, researchers should consider:

  • Expression strain selection:

    • Use specialized strains designed for membrane protein expression

    • Consider BL21ΔABCF strain (with deletions of abundant outer membrane proteins) to potentially improve YhhQ yield

    • These engineered strains have shown improved expression of various membrane proteins compared to standard BL21(DE3)

  • Expression optimization:

    • Test different induction temperatures (30°C is often suitable for membrane proteins)

    • Optimize inducer concentration (IPTG or anhydrotetracycline)

    • Control induction timing (typically mid-log phase, OD₆₀₀ ~0.5)

    • Consider lower expression temperatures to improve proper folding

  • Membrane fraction isolation:

    • Use differential centrifugation to separate inner and outer membranes

    • Apply detergent screening to identify optimal solubilization conditions for YhhQ

  • Purification approach:

    • Include affinity tags (His, HA, or other) for purification

    • Employ size exclusion chromatography as a final purification step

  • Quality control:

    • Verify expression by immunoblotting or mass spectrometry

    • Assess protein folding through circular dichroism or functional assays

How does the substrate specificity of YhhQ differ across bacterial species?

The substrate specificity of YhhQ appears to vary across bacterial species, as revealed by sequence similarity network (SSN) analysis:

  • Variation in preference:

    • E. coli YhhQ shows preference for preQ₀ over preQ₁

    • Other bacterial YhhQ homologs may preferentially transport preQ₁ or even queuine

    • These preferences correlate with the presence of other Q-pathway enzymes

  • Structural determinants:

    • Sequence analysis reveals the absence of universally conserved residues across the entire COG1738 family

    • Distinct clustering patterns emerge when analyzing YhhQ sequences at different SSN alignment score thresholds

    • At higher stringency thresholds, YhhQ sequences cluster according to the Q salvage pathway configuration in their respective organisms

  • Functional implications:

    • Organisms lacking QueF (which converts preQ₀ to preQ₁) likely have YhhQ variants optimized for preQ₁ transport

    • These differences suggest evolutionary adaptation of YhhQ to complement the specific Q-pathway variant present in each organism

The research indicates that YhhQ has evolved substrate specificity determinants that align with the particular salvage requirements of each bacterial species, though the precise molecular basis for these preferences requires further investigation .

What structural features of YhhQ are essential for its transport function?

While a complete structural characterization of YhhQ is still emerging, several features appear important for function:

  • Transmembrane topology:

    • YhhQ is an inner membrane protein with multiple predicted transmembrane domains

    • The precise arrangement of these domains likely creates a channel or pore for substrate passage

  • Sequence conservation patterns:

    • Analysis of YhhQ sequences reveals subfamilies with distinct conservation patterns

    • These conservation differences likely reflect adaptations for different substrate preferences

  • Putative binding site characteristics:

    • As a transporter for preQ₀/preQ₁, YhhQ likely contains binding pockets accommodating these deazaguanine derivatives

    • The preference of E. coli YhhQ for preQ₀ over preQ₁ suggests structural elements discriminating between these similar compounds

  • Potential partner interactions:

    • Experimental data suggest YhhQ may function with unidentified partners

    • The transport mechanism may involve conformational changes requiring specific structural elements

  • Relationship to other transporters:

    • YhhQ belongs to COG1738 family but its structural relationship to other transporter families is not fully characterized

    • Understanding shared features with purine transporters could provide insight into its mechanism, especially since non-specific transporters can import preQ₀ at low efficiency

What are the kinetic parameters of YhhQ-mediated transport, and how do they compare across different substrates?

A comprehensive kinetic analysis of YhhQ-mediated transport would include:

  • Transport kinetics determination:

    ParameterPreQ₀PreQ₁Method
    KmLower*Higher*Time-course Q formation assay
    VmaxTBDTBDDirect transport assays
    Transport efficiency (Vmax/Km)Higher*Lower*Calculated from above
    *Based on indirect evidence showing preferential incorporation of preQ₀
  • Competition studies:

    • Testing whether other purines compete with preQ₀/preQ₁ transport

    • Determining IC₅₀ values for potential inhibitors

    • Assessing whether structural analogs can be transported

  • Environmental effects:

    • pH dependence of transport activity

    • Temperature effects on transport kinetics

    • Influence of membrane composition on transport efficiency

  • Energy coupling:

    • Determining whether transport is active or passive

    • Identifying any co-transported ions or molecules

    • Assessing ATP or proton gradient requirements

Current research has indirectly shown that E. coli YhhQ more efficiently transports preQ₀ compared to preQ₁ when both are provided at the same concentration (10 nM), but comprehensive kinetic parameters remain to be determined through direct transport assays .

How can researchers differentiate between direct and indirect effects when studying YhhQ function?

To distinguish direct YhhQ functions from indirect effects, researchers should consider:

  • Complementation controls:

    • Use plasmid-based complementation of ΔyhhQ strains

    • Include empty vector controls

    • Test multiple expression levels to avoid artifacts from overexpression

  • Substrate specificity verification:

    • Test multiple structurally related compounds

    • Include non-substrate controls

    • Perform competition assays between potential substrates

  • Direct vs. indirect assays:

    • Develop direct transport assays using radiolabeled or fluorescently labeled substrates

    • Compare with indirect assays (like Q-modification in tRNA)

    • Reconcile any discrepancies between direct and indirect measures

  • Addressing redundancy:

    • Extended incubation times may reveal non-specific transport through other systems

    • Test double or triple knockouts of YhhQ and related transporters

    • Quantify the contribution of specific vs. non-specific transport

  • In vitro reconstitution:

    • Purify YhhQ and reconstitute in liposomes or nanodiscs

    • Test transport activity in the controlled system

    • Verify that purified YhhQ alone is sufficient for transport

In published research, extended incubation times revealed small amounts of Q-modified tRNAs even in yhhQ⁻ strains, suggesting the existence of non-specific transport mechanisms for preQ₀ in E. coli, possibly through known purine transporters .

What reference genes should be used when analyzing YhhQ expression by qPCR?

For accurate qPCR analysis of YhhQ expression in E. coli, researchers should:

  • Use validated reference genes:

    GeneFunctionStability Value*Recommendation
    cysGSiroheme synthaseHighHighly recommended
    hcaT3-phenylpropionate permeaseHighHighly recommended
    idnTL-idonate/5-ketogluconate/gluconate transporterHighHighly recommended
    rrsA (16S rRNA)Ribosomal RNALowNot recommended alone
    ihfBIntegration host factor beta subunitLowNot recommended alone
    *Stability across different growth conditions and protein overexpression scenarios
  • Apply geometric averaging:

    • Calculate the geometric mean of at least three stable reference genes

    • This approach minimizes the effect of any single gene's variation

    • Provides more reliable normalization than any single reference gene

  • Validate stability in specific conditions:

    • Verify reference gene stability under your specific experimental conditions

    • Consider temperature, growth phase, and recombinant protein expression effects

    • Use statistical algorithms (GeNorm, NormFinder, BestKeeper) to assess stability

  • Control for technical variables:

    • Ensure consistent RNA extraction efficiency

    • Verify reverse transcription efficiency

    • Include appropriate controls for all steps

Research has demonstrated that commonly used reference genes like rrsA (16S rRNA) may lead to misinterpretation of data, while genes like cysG, hcaT, and idnT provide more consistent normalization for E. coli gene expression studies during protein overexpression .

What strain engineering approaches can enhance YhhQ expression for structural studies?

For structural studies requiring high yields of properly folded YhhQ:

  • Specialized expression strains:

    • Use BL21ΔABCF strain with deletions of abundant outer membrane proteins

    • Consider C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • Evaluate Lemo21(DE3) for tunable expression levels

  • Genetic modifications:

    • Reduce proteolytic degradation by using protease-deficient strains

    • Consider genomic integration of yhhQ for stable, controlled expression

    • Engineer strains with altered membrane composition if native membrane environment poses challenges

  • Expression optimization:

    • Test various induction temperatures (typically 18-30°C for membrane proteins)

    • Evaluate different inducers and concentrations

    • Consider auto-induction media for gradual protein production

  • Fusion strategies:

    • Test N- or C-terminal fusions with solubility-enhancing partners

    • Include cleavable affinity tags for purification

    • Consider fusion partners that facilitate crystallization

  • Media and growth conditions:

    • Evaluate defined vs. complex media impacts on expression

    • Test effect of supplements like extra phospholipids

    • Optimize aeration and growth conditions

The engineered BL21ΔABCF strain has demonstrated improved expression of various membrane proteins compared to the parent BL21(DE3) strain, suggesting it may be beneficial for YhhQ expression. This strain has deletions of genes encoding abundant outer membrane proteins, potentially freeing up cellular resources for recombinant protein production .

How might YhhQ function be exploited in metabolic engineering applications?

YhhQ's transport capabilities could be leveraged in several metabolic engineering contexts:

  • Enhanced tRNA modification systems:

    • Overexpression of YhhQ could increase queuosine incorporation in tRNAs

    • This may improve translation fidelity and efficiency for recombinant protein production

    • Could be particularly valuable for producing proteins with rare codons

  • Precursor delivery systems:

    • YhhQ could be engineered to transport modified precursors for novel nucleoside production

    • May enable incorporation of synthetic nucleoside analogs into RNA

    • Could facilitate isotope labeling strategies for structural studies

  • Biosensor development:

    • YhhQ-based biosensors could detect specific purine analogs

    • Coupling transport to reporter systems could enable screening applications

    • May be useful for environmental monitoring or drug discovery

  • Synthetic pathway enhancement:

    • In organisms engineered to produce queuosine-related compounds, optimized YhhQ variants could improve precursor utilization

    • Could increase pathway efficiency by facilitating substrate channeling

  • Antibiotic development:

    • Understanding YhhQ transport mechanisms could enable the design of compounds that hijack this transporter

    • May provide new strategies for antibiotic delivery into bacterial cells

What techniques could reveal the detailed transport mechanism of YhhQ?

Elucidating YhhQ's transport mechanism would require a multi-disciplinary approach:

  • Structural determination methods:

    • X-ray crystallography of YhhQ in different conformational states

    • Cryo-electron microscopy to capture transport intermediates

    • NMR studies of dynamic regions involved in substrate recognition

  • Biophysical characterization:

    • Single-molecule FRET to monitor conformational changes during transport

    • Isothermal titration calorimetry to determine binding parameters

    • Stopped-flow spectroscopy to measure transport kinetics

  • Computational approaches:

    • Molecular dynamics simulations of YhhQ with substrates

    • Quantum mechanical calculations for substrate interaction energetics

    • Machine learning models to predict substrate specificities across homologs

  • Functional assays:

    • Development of reconstituted liposome-based transport assays

    • Patch-clamp studies if YhhQ forms a channel

    • Fluorescence-based assays for real-time transport monitoring

  • Mutagenesis strategy:

    • Alanine scanning mutagenesis of conserved residues

    • Creation of chimeric transporters between YhhQ homologs with different specificities

    • Directed evolution to select for variants with altered transport properties

How does YhhQ interact with the broader cellular machinery in E. coli?

Understanding YhhQ's integration within cellular systems requires:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid screens for interacting partners

    • Proximity labeling approaches to identify neighboring proteins

  • Systems biology approaches:

    • Transcriptome analysis in ΔyhhQ vs. wild-type strains

    • Metabolomics to identify altered metabolite pools

    • Flux analysis to determine effects on central metabolism

  • Genetic interaction mapping:

    • Synthetic genetic array analysis with yhhQ deletion

    • Chemical-genetic profiling to identify conditions requiring YhhQ

    • Suppressor screens to identify genes that compensate for yhhQ loss

  • Regulatory network analysis:

    • ChIP-seq to identify transcription factors binding the yhhQ promoter

    • Riboswitch characterization to understand post-transcriptional regulation

    • Small RNA interactions affecting yhhQ expression

  • Cellular localization studies:

    • Super-resolution microscopy to determine membrane distribution

    • Co-localization with other transporters or metabolic enzymes

    • Dynamics of expression and localization during different growth phases

Current evidence suggests YhhQ may function with unknown partner proteins, and understanding these interactions could reveal new aspects of queuosine metabolism regulation and membrane transport mechanisms in E. coli .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.