Recombinant Escherichia coli Inner membrane protein yiaA (yiaA)

Shipped with Ice Packs
In Stock

Description

Introduction to Escherichia coli Inner Membrane Protein YiaA

The Escherichia coli genome contains numerous genes encoding membrane proteins that play crucial roles in cellular processes, including transport, signaling, and maintenance of membrane integrity. The yiaA gene encodes an inner membrane protein that is part of the complex network of membrane-associated proteins in E. coli. While many membrane proteins in E. coli have been extensively characterized, such as YidC, which functions as a membrane protein chaperone in cooperation with the Sec translocon , the YiaA protein remains relatively understudied in comparison.

Inner membrane proteins of E. coli typically contain transmembrane helices that anchor them to the lipid bilayer. The recombinant expression of these proteins has been crucial for structural and functional studies, allowing researchers to investigate their properties outside their native cellular environment. Recombinant E. coli inner membrane protein YiaA refers to the artificially expressed form of this protein, often produced with affinity tags to facilitate purification and subsequent analysis.

Primary Structure and Sequence Analysis

The full-length inner membrane protein YiaA from E. coli consists of 145 amino acid residues. Based on available data from the homologous protein in Shigella flexneri, the amino acid sequence of YiaA contains primarily hydrophobic residues that form transmembrane domains interspersed with hydrophilic regions . The protein sequence of YiaA from Shigella flexneri, which shares high homology with E. coli YiaA, is:

MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRDKYEGIPTTSIYYMTCLTVFIISVALLMVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRDAGINPPKETQVTQEEYSE

This sequence information provides insights into the potential structure of E. coli YiaA, suggesting a similar arrangement of hydrophobic and hydrophilic domains that determine its membrane topology.

Expression Systems

Recombinant expression of E. coli YiaA typically employs E. coli-based expression systems, similar to those used for other membrane proteins. The expression of inner membrane proteins often presents challenges due to their hydrophobic nature and potential toxicity when overexpressed. To overcome these challenges, researchers commonly use controlled expression systems with inducible promoters and specialized E. coli strains designed for membrane protein production.

Affinity Tags and Purification Methods

For purification purposes, recombinant YiaA is frequently expressed with affinity tags, most commonly a polyhistidine (His) tag. The addition of a His-tag at either the N-terminus or C-terminus facilitates purification using metal-chelate affinity chromatography . This approach has been successfully employed for the purification of various membrane proteins from E. coli, including YidC and other inner membrane proteins.

The typical purification protocol for His-tagged recombinant YiaA involves:

  1. Cell lysis to release membrane fractions

  2. Membrane solubilization using detergents

  3. Immobilized metal affinity chromatography (IMAC)

  4. Optional additional purification steps (size exclusion, ion exchange)

Comparison with Other E. coli Membrane Proteins

When compared to other well-characterized E. coli membrane proteins, YiaA represents a distinct protein class. Unlike YidC, which functions as a membrane protein chaperone and insertase , or YigI, which has been identified as an acyl-CoA thioesterase , the specific functional role of YiaA remains less defined. This highlights the importance of further research to elucidate the physiological significance of YiaA in E. coli.

Potential Functional Roles

While direct experimental evidence for the function of E. coli YiaA is limited in the provided search results, potential roles can be inferred based on its membrane localization and comparisons with other membrane proteins.

As an inner membrane protein, YiaA may participate in:

  1. Membrane integrity and organization

  2. Transport processes across the inner membrane

  3. Signal transduction between the periplasm and cytoplasm

  4. Protein-protein interactions within the membrane environment

It's worth noting that other E. coli proteins with initially unclear functions have later been characterized to play important roles. For example, YigI was recently identified as a medium- to long-chain acyl-CoA thioesterase involved in fatty acid metabolism , highlighting how functional characterization can reveal important metabolic roles for previously understudied proteins.

Experimental Approaches for Studying YiaA

Several experimental approaches can be employed to study the structure and function of recombinant E. coli YiaA:

  1. Recombinant expression and purification for in vitro studies

  2. Site-directed mutagenesis to identify critical residues

  3. Protein-protein interaction studies to identify binding partners

  4. Membrane reconstitution experiments

  5. Functional assays based on phenotypic analysis of deletion mutants

Data Collection and Analysis

Research involving membrane proteins like YiaA typically requires careful data collection and analysis protocols. When designing experiments involving YiaA, researchers must consider appropriate controls and data presentation formats. Table 1 illustrates a suggested experimental design for studying YiaA expression under different conditions:

Table 1: Template for YiaA Expression Analysis Under Varying Conditions

Experimental ConditionTrial 1Trial 2Trial 3Trial 4Trial 5Average Expression
Condition A
Condition B
Condition C

This table format follows established protocols for experimental data presentation in scientific research, ensuring clarity and reproducibility4.

Functional Studies

Gene deletion studies, complementation experiments, and interactome analyses could help elucidate the physiological role of YiaA in E. coli. Drawing parallels from research on other E. coli membrane proteins, such as YidC or YigI , similar methodologies could be applied to characterize YiaA function.

Biotechnological Applications

Exploring potential biotechnological applications of recombinant YiaA, such as its use as a membrane protein expression tag or its incorporation into artificial membrane systems, represents another promising research direction.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yiaA; b3562; JW3534; Inner membrane protein YiaA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-145
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yiaA
Target Protein Sequence
MDNKISTYSPAFSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQK TVRDKYEGIPTTSIYYMTCLTVFIISVALLMVGLWNATLLLSEKGFYGLAFFLSLFGAVA VQKNIRDAGINPPKETQVTQEEYSE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the general structure and function of yiaA in Escherichia coli?

The yiaA protein is a small inner membrane protein in Escherichia coli with a single transmembrane segment (TMS). Similar to other inner membrane proteins like YibN, yiaA likely has a specific orientation relative to the cytosol. Understanding the structure-function relationship of yiaA requires examining its membrane topology, which can be determined through fusion protein approaches and protease accessibility assays. Most inner membrane proteins in E. coli serve critical roles in membrane integrity, transport, or as part of larger protein complexes. The specific function of yiaA may be related to membrane organization, similar to how YibN interacts with YidC to enhance membrane protein insertion and influence lipid organization .

Which experimental approaches are most effective for initial characterization of yiaA?

For initial characterization of yiaA, researchers should employ multiple complementary approaches:

  • Proximity-dependent biotin labeling (BioID): This technique can identify proteins that interact with yiaA in its native environment, providing clues about its functional role. This approach was successfully used to identify YibN as an interactor of YidC .

  • Affinity purification-mass spectrometry: This can confirm protein-protein interactions identified through BioID and identify additional interaction partners .

  • On-gel binding assays: After purifying yiaA in appropriate detergents (typically DDM), blue-native PAGE can be used to visualize protein complexes formed with potential interaction partners .

  • Transmembrane segment analysis: Deletion mutants (especially of the TMS) can determine which regions are essential for protein-protein interactions, similar to how deleting YibN's TMS abolished its interaction with YidC .

How can researchers differentiate between direct and indirect effects of yiaA on membrane dynamics?

To differentiate between direct and indirect effects of yiaA on membrane dynamics:

  • In vitro reconstitution: Purify yiaA and reconstitute it in liposomes with defined lipid composition to observe direct effects on membrane properties.

  • Electron microscopy analysis: Compare membrane morphology in cells overexpressing yiaA versus control cells, looking for changes in membrane proliferation or organization similar to those observed with YibN overexpression .

  • Lipid extraction and thin-layer chromatography: Quantify changes in membrane lipid composition and abundance when yiaA is overexpressed or deleted .

  • Comparative studies: Express other small membrane proteins as controls to determine if observed effects are specific to yiaA or represent general responses to membrane protein overproduction.

What are the optimal conditions for recombinant yiaA expression in E. coli?

For optimal expression of recombinant yiaA in E. coli:

Expression System Parameters:

ParameterRecommended ConditionRationale
Host strainC43(DE3) or BL21(DE3) pLysSBetter tolerance for membrane protein expression
PlasmidpBAD vector seriesAllows tight control of expression
Induction0.1% arabinoseGentle induction minimizes toxicity
Temperature20-25°CSlower expression improves folding
Duration3-4 hoursPrevents excessive membrane stress
MediaLB or 2×YT with glycerol (0.5%)Supports membrane formation

The key to successful membrane protein expression is balancing sufficient yield with minimal cellular toxicity. Expression at lower temperatures (20-25°C) allows proper membrane integration, similar to the conditions used for expression of YidC substrates that showed enhanced production in the presence of YibN . Expression should be monitored using Western blot analysis at 15-minute intervals after induction to determine the optimal harvesting time.

What purification strategy yields the highest purity and activity for yiaA?

A multi-step purification strategy is recommended for yiaA:

  • Membrane isolation: Disrupt cells via sonication or French press, then separate inner membranes using sucrose gradient ultracentrifugation (similar to methods used for YibN purification) .

  • Detergent solubilization: Solubilize membranes with n-dodecyl-β-D-maltopyranoside (DDM) at 1% (w/v) for 1 hour at 4°C. This detergent maintains membrane protein structure and function better than harsher detergents like SDS.

  • Affinity chromatography: Purify His-tagged yiaA using Ni-NTA resin with imidazole gradient elution.

  • Size exclusion chromatography: Further purify using gel filtration to separate monomeric from aggregated protein.

  • Assessment: Confirm purity by SDS-PAGE and functionality through binding assays with known interactors or functional reconstitution.

When characterizing oligomeric states, blue-native PAGE is recommended over SDS-PAGE to preserve native protein-protein interactions, similar to the approach that revealed the YidC-YibN complex .

How can researchers troubleshoot poor expression yields of recombinant yiaA?

When facing poor expression yields of recombinant yiaA:

  • Codon optimization: Analyze the yiaA sequence for rare codons and optimize accordingly for E. coli expression.

  • Co-expression with facilitators: Consider co-expressing with membrane protein biogenesis facilitators. Similar to how YibN enhances production of certain membrane proteins , identifying proteins that enhance yiaA production could improve yields.

  • Fusion tags optimization: Test different solubility-enhancing tags (e.g., MBP, SUMO) at N or C termini, while being mindful of potential interference with membrane integration.

  • Expression conditions matrix:

    • Test multiple induction concentrations (0.01-0.2% arabinose)

    • Vary induction time (2-16 hours)

    • Test different temperatures (16-30°C)

    • Try different media formulations (TB, LB, minimal media)

  • Membrane fraction analysis: Evaluate whether yiaA is properly integrated into membranes or forming inclusion bodies through subcellular fractionation.

Which techniques are most appropriate for determining the membrane topology of yiaA?

To determine membrane topology of yiaA, multiple complementary approaches should be combined:

  • Fusion protein approach: Create systematic fusions of yiaA with reporter proteins like alkaline phosphatase (PhoA) and green fluorescent protein (GFP) at various positions. PhoA is active in the periplasm but not cytoplasm, while GFP fluoresces in the cytoplasm but not periplasm.

  • Cysteine accessibility method: Introduce cysteine residues at predicted loop regions and test their accessibility to membrane-impermeable sulfhydryl reagents from either side of the membrane.

  • Protease protection assays: Use proteases like proteinase K on purified inverted membrane vesicles (IMVs) and right-side-out vesicles to identify protected fragments corresponding to different membrane topologies, similar to the analysis performed for SecG in the YibN study .

  • In silico prediction combined with experimental validation: Use topology prediction algorithms (TMHMM, Phobius) as a starting point, then validate with the experimental approaches above.

How can researchers distinguish between monomeric and oligomeric forms of yiaA?

To distinguish between monomeric and oligomeric forms of yiaA:

  • Blue-native PAGE: Run purified yiaA on blue-native gels with appropriate molecular weight markers to visualize native complexes, similar to the approach that revealed the YidC-YibN complex .

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS): This technique provides accurate molecular weight determination of protein complexes in detergent solutions.

  • Chemical crosslinking: Use membrane-permeable crosslinkers of various arm lengths followed by SDS-PAGE and immunoblotting to capture transient interactions.

  • Analytical ultracentrifugation: Sedimentation velocity experiments can distinguish different oligomeric species in solution.

  • FRET analysis: For in vivo studies, tag yiaA with fluorescent proteins capable of Förster resonance energy transfer (FRET) to detect proximity-dependent interactions.

What are the advantages and limitations of using cryo-EM versus X-ray crystallography for structural characterization of yiaA?

Comparison of Cryo-EM and X-ray Crystallography for yiaA Structural Characterization:

AspectCryo-Electron MicroscopyX-ray CrystallographyImplication for yiaA Research
Sample preparationProteins embedded in vitreous ice, maintaining native membrane environmentRequires crystal formation, often challenging for membrane proteinsCryo-EM may better preserve native conformation of yiaA
Detergent requirementsLess stringent; compatible with larger micellesRequires finding detergents suitable for crystallizationCryo-EM offers more flexibility in detergent selection
Sample quantityRequires microgram quantitiesTypically requires milligram quantitiesCryo-EM advantageous when expression yields are limited
Resolution potentialRecently achieving 2-3Å for membrane proteinsCan achieve atomic resolution (<2Å) when crystals are high qualityBoth can potentially provide high-resolution data depending on the system
Conformational heterogeneityCan computationally sort different conformational statesTypically captures single conformational stateCryo-EM better for capturing functional dynamics of yiaA
Protein size limitationsMore challenging for proteins <50 kDaNo theoretical lower size limitX-ray crystallography may be better for small proteins like yiaA
Complex visualizationExcellent for visualizing protein complexesChallenging to crystallize dynamic complexesCryo-EM advantageous for studying yiaA with interaction partners

For small membrane proteins like yiaA, researchers should consider a combined approach: initial structural characterization using X-ray crystallography (if crystals can be obtained) followed by cryo-EM studies of yiaA in complex with interaction partners to understand its functional context within the membrane environment.

How can researchers identify and validate protein-protein interactions involving yiaA?

To identify and validate protein-protein interactions involving yiaA:

  • Proximity-dependent biotin labeling (BioID): Fuse a biotin ligase to yiaA and express in E. coli to identify proteins in its proximity. This technique successfully identified YibN as an interactor of YidC in bacterial membranes .

  • SILAC-based affinity purification/mass spectrometry: Use stable isotope labeling with amino acids in cell culture combined with affinity purification and mass spectrometry to quantitatively assess protein-protein interactions, similar to the approach that confirmed reciprocal capture of YidC and YibN .

  • Co-immunoprecipitation from native membranes: Use antibodies against yiaA to pull down potential interaction partners from solubilized membranes.

  • On-gel binding assays: Purify His-tagged yiaA and potential interaction partners, then analyze complex formation using blue-native PAGE, as demonstrated for YidC-YibN interaction .

  • Bacterial two-hybrid system: Specially designed for membrane protein interactions, this genetic approach can screen for potential interactors in vivo.

  • Validation through functional assays: After identifying potential interactors, validate their functional significance through co-expression studies and phenotypic analysis of deletion mutants.

What methods can be used to investigate the role of yiaA in membrane protein biogenesis?

To investigate yiaA's potential role in membrane protein biogenesis:

  • Co-expression studies: Express known membrane protein substrates with or without yiaA overexpression and analyze their production levels. This approach revealed YibN's enhancement of YidC substrate production .

  • In vitro translation/insertion assays: Use inverted membrane vesicles (INVs) enriched with yiaA to assess insertion efficiency of various membrane proteins, following methods similar to those used to demonstrate YibN's stimulation of protein insertion :

    • Prepare INVs from strains overexpressing yiaA

    • Perform in vitro translation with radiolabeled amino acids

    • Measure membrane insertion by protease protection assays

    • Compare with control INVs to quantify enhancement effects

  • Depletion studies: Create a conditional yiaA depletion strain and monitor effects on global membrane proteome composition using quantitative proteomics.

  • Site-directed mutagenesis: Identify critical residues in yiaA and assess their impact on facilitating membrane protein biogenesis.

How does yiaA potentially influence membrane lipid composition and organization?

To investigate yiaA's influence on membrane lipid composition and organization:

  • Lipid extraction and thin-layer chromatography (TLC): Extract total membrane lipids from strains with varied yiaA expression levels and analyze by TLC to quantify changes in major phospholipid species (PE, PG), similar to the analysis that revealed YibN overproduction increased membrane lipid production ~4-fold .

  • Transmission electron microscopy: Prepare thin sections of cells with varied yiaA expression to visualize changes in membrane morphology, looking for proliferation, circumvolutions, or multilayered structures similar to those observed with YibN overexpression .

  • Lipid scramblase activity assay: If yiaA potentially functions as a lipid scramblase (similar to YidC ), assess inner-to-outer leaflet lipid movement using fluorescently labeled phospholipids.

  • Membrane fluidity measurements: Use fluorescence anisotropy with membrane-embedded fluorophores to detect changes in membrane fluidity associated with yiaA expression levels.

  • Lipidomics analysis: Perform mass spectrometry-based lipidomics to comprehensively profile all lipid species altered by yiaA manipulation, providing insights beyond the major phospholipid classes.

How can researchers design experiments to investigate potential functional redundancy between yiaA and other membrane proteins?

To investigate potential functional redundancy between yiaA and other membrane proteins:

  • Double knockout/depletion studies: Create strains with combinations of deletions or depletions of yiaA and related proteins, then assess phenotypic consequences. Synthetic lethality or exacerbated phenotypes suggest functional redundancy.

  • Complementation experiments: Test whether overexpression of yiaA can rescue phenotypes caused by depletion of other membrane proteins and vice versa.

  • Domain swapping: Create chimeric proteins by swapping domains between yiaA and related proteins to identify which regions confer specific functions.

  • Substrate profiling: Systematically test whether yiaA and related proteins affect the biogenesis of the same set of membrane protein substrates or have distinct substrate preferences, similar to the approach used to compare YibN effects on different membrane proteins .

  • Evolutionary analysis: Examine the co-occurrence patterns of yiaA and related proteins across bacterial species to infer functional relationships.

What approaches can resolve contradictory data about yiaA function in different experimental systems?

When faced with contradictory data about yiaA function:

  • Strain background validation: Verify that observed differences aren't due to secondary mutations in laboratory strains by complementation and whole-genome sequencing.

  • Expression level considerations: Quantify yiaA expression levels across experimental systems, as different phenotypes may emerge at physiological versus overexpression levels.

  • Substrate-specific effects: Systematically test effects on multiple substrates, as yiaA may have differential effects on different classes of membrane proteins, similar to how YibN enhanced specific YidC substrates but not all membrane proteins .

  • Conditional functionality: Examine whether yiaA function depends on specific growth conditions, stress responses, or genetic backgrounds.

  • Resolution through in vitro reconstitution: Recreate minimal systems in vitro with defined components to identify essential factors for yiaA function and sources of variability.

  • Multi-laboratory validation: Standardize protocols and perform identical experiments across different laboratories to identify sources of variation.

How can advanced biophysical techniques be adapted to study dynamic changes in yiaA conformation during membrane protein insertion?

To study dynamic changes in yiaA conformation during membrane protein insertion:

  • Single-molecule FRET (smFRET): Label pairs of residues in yiaA with fluorophores and monitor distance changes during substrate processing.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Compare deuterium uptake profiles of yiaA alone versus yiaA with substrates to identify regions involved in interactions and conformational changes.

  • Electron paramagnetic resonance (EPR) spectroscopy: Introduce spin labels at strategic positions in yiaA to monitor local environmental changes during substrate binding and processing.

  • Time-resolved cross-linking: Use photo-activatable crosslinkers to capture transient interaction states between yiaA and substrates at different stages of the insertion process.

  • Molecular dynamics simulations: Develop computational models of yiaA in membrane environments to predict conformational changes and validate with experimental data.

  • Cryo-electron tomography of intact membranes: Visualize yiaA in native membrane environments during active protein insertion, potentially capturing different conformational states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.