Recombinant Escherichia coli Inner membrane protein yiaB (yiaB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your consideration.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us; we will prioritize developing it to meet your specifications.
Synonyms
yiaB; b3563; JW5654; Inner membrane protein YiaB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yiaB
Target Protein Sequence
MKTSKTVAKLLFVVGALVYLVGLWISCPLLSGKGYFLGVLMTATFGNYAYLRAEKLGQLD DFFTHICQLVALITIGLLFIGVLNAPINTYEMVIYPIAFFVCLFGQMRLFRSA
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the primary challenges in expressing recombinant inner membrane proteins in E. coli?

Expression of inner membrane proteins in E. coli often presents several key challenges that researchers must overcome:

The insertion of overexpressed membrane proteins can overload the membrane protein insertion machinery, particularly the YidC insertase system, causing cellular stress and reduced expression. YidC is essential for the biogenesis of the bacterial inner membrane, influencing both protein composition and lipid organization . Additionally, protein toxicity, improper folding, and cellular burden from protein overexpression frequently lead to poor yields. Membrane proteins may also form inclusion bodies when expression exceeds the capacity of membrane insertion machinery.

To overcome these challenges, researchers should consider optimization strategies including using specialized expression strains, adjusting induction conditions (temperature, inducer concentration), and exploring co-expression with chaperones. Recent research has demonstrated that co-expression with proteins such as YibN can enhance membrane protein expression by promoting proper insertion and possibly regulating membrane composition .

Which E. coli strains are most suitable for inner membrane protein expression?

The selection of appropriate E. coli strains is critical for successful membrane protein expression:

While standard laboratory strains like BL21(DE3) are commonly used for protein expression, specialized strains may provide better results for membrane proteins. The search results indicate that BL21(DE3) has been successfully employed for membrane protein expression studies . When selecting a strain, consider:

  • Strains with mutations that reduce protein degradation (e.g., ompT-, lon-)

  • Strains with altered membrane composition

  • Strains with reduced expression leakiness before induction

Interestingly, research has identified that specific genetic alterations can significantly improve membrane protein expression. A systematic approach using transposon mutagenesis has identified genetic loci that, when disrupted, improve the expression of various inner membrane proteins including CyoB, CydB, MdlB, YidC, and LepI . This suggests that creating or selecting strains with specific genetic alterations could substantially improve membrane protein yields.

How does the YidC membrane insertase system influence membrane protein expression?

The YidC system plays a crucial role in membrane protein insertion and folding:

YidC functions both in association with the Sec translocon and independently as an insertase and lipid scramblase. It aids in the proper folding of multi-pass membrane proteins while working with the Sec translocon and independently facilitates the insertion of smaller membrane proteins . Recent research has identified YibN as a significant interactor of YidC. This interaction appears to enhance the production and membrane insertion of YidC substrates such as M13 and Pf3 phage coat proteins, ATP synthase subunit c, and various small membrane proteins including SecG .

The YidC-YibN interaction was confirmed through multiple experimental approaches, including:

  • Proximity-dependent biotin labeling (BioID)

  • Affinity purification-mass spectrometry assays

  • On-gel binding assays with purified proteins

  • Native-gel electrophoresis showing a distinctive band when YidC and YibN are incubated together

These findings suggest that co-expression with YibN or other YidC interactors might be a valuable strategy for increasing yields of difficult-to-express membrane proteins.

What expression vector systems provide optimal results for inner membrane protein production?

The choice of expression vector significantly impacts membrane protein production success:

For effective membrane protein expression, consider vectors with these key features:

  • Tightly regulated promoters (e.g., T7-lac, araBAD) to prevent leaky expression

  • Appropriate affinity tags that don't interfere with membrane insertion

  • Compatibility with co-expression systems for chaperones or helper proteins

The search results indicate that plasmids like pBAD33, pMS119, and pET20 have been used successfully for membrane protein expression . The arabinose-inducible pBAD system allows for fine-tuned expression levels by adjusting arabinose concentrations (typically 0.1-0.2%), while IPTG-inducible systems like pET offer strong expression but may require stricter regulation to prevent toxicity .

When designing co-expression experiments, compatibility between plasmids is crucial. For example, researchers have successfully co-transformed pMS119 (carrying membrane protein genes) with pBAD33 (carrying YibN) with selection on dual antibiotics (Ampicillin and Chloramphenicol) .

What induction strategies maximize functional membrane protein yields?

Optimizing induction conditions is essential for balancing protein expression and proper membrane insertion:

Research suggests a staged induction approach can be beneficial. For co-expression systems, consider inducing helper proteins first, followed by the target membrane protein. For example:

  • First induce helper proteins (e.g., YibN) with 0.1% arabinose for 15 minutes

  • Then induce the target membrane protein with 0.75 mM IPTG for 1.5-2 hours

Temperature control is also critical - lower temperatures (25°C or room temperature) slow protein synthesis, allowing more time for proper membrane insertion. The research indicates that cultivation at 25°C prior to protein induction can improve membrane protein expression .

Additionally, induction duration should be optimized for each protein. Time-course experiments with sample collection at 15-minute intervals can help determine the optimal expression window before toxicity effects become significant .

How can researchers monitor membrane protein expression and localization effectively?

Multiple complementary techniques should be employed to confirm proper expression and localization:

  • Fluorescent protein fusions: GFP fusions can serve as real-time indicators of expression levels and proper folding. The intensity of GFP can be used as a proxy for increased protein expression .

  • Western blotting: For time-course analysis of expression levels, collect aliquots at regular intervals and analyze by SDS-PAGE followed by Western blotting with appropriate antibodies .

  • Membrane fractionation: Prepare inverted membrane vesicles (INVs) to confirm protein localization to the membrane fraction. Sucrose gradient centrifugation can be used to separate inner and outer membranes .

  • Protease protection assays: To verify proper membrane insertion topology, treat samples with proteinase K to generate membrane-protected fragments (MPFs), which serve as indicators of successful membrane insertion .

  • Electron microscopy: Transmission electron microscopy can visualize membrane proliferation and alterations in membrane structure associated with protein overexpression .

These techniques can be combined to provide comprehensive evidence of successful membrane protein expression and proper localization.

What techniques can identify interacting partners of inner membrane proteins?

Multiple complementary approaches can be used to identify and validate protein-protein interactions:

The search results highlight several effective techniques for detecting membrane protein interactions:

  • Proximity-dependent biotin labeling (BioID): This technique identifies proteins in close proximity to the target protein by fusing it with a biotin ligase that biotinylates nearby proteins, allowing their subsequent purification and identification .

  • Affinity purification-mass spectrometry: This approach uses tagged proteins to pull down interaction partners from native membranes, followed by mass spectrometry identification .

  • On-gel binding assays: Purified proteins can be analyzed using native-gel electrophoresis to detect complex formation. For example, YidC and YibN form a distinctive band when incubated together, confirming their direct interaction .

  • Blue-native PAGE: This technique preserves native protein complexes during electrophoresis. It was used to confirm the YidC-YibN interaction, showing a distinctive band (labeled YY) when both proteins were present .

  • Deletion analysis: To map interaction domains, researchers can create truncated protein versions. For instance, deletion of the YibN transmembrane segment (residues 1-29) abolished its interaction with YidC, demonstrating the essential role of this domain in complex formation .

How does membrane lipid composition affect protein insertion and function?

Membrane lipid composition significantly impacts protein insertion efficiency and functional activity:

Research indicates that alterations in membrane lipid composition can profoundly affect membrane protein expression and function. The overexpression of YibN was found to stimulate membrane lipid production, with approximately 4-fold more membrane lipids produced compared to control strains . Thin-layer chromatography (TLC) analysis confirmed that phosphoethanolamine (PE) and phosphoglycerol (PG) remained the predominant lipid species .

Electron microscopy studies revealed that YibN overproduction is associated with significant membrane alterations, including:

  • Membrane proliferation

  • Circumvolutions

  • Formation of multilayered structures, primarily at the inner membrane

  • Less pronounced effects on the outer membrane structure

These findings suggest that membrane protein expression can be enhanced by modulating membrane lipid composition. The apparent effect of YibN on membrane proliferation may be related to interference with YidC lipid scramblase activity, highlighting the complex interplay between membrane proteins and lipid organization .

What is the role of transmembrane segment hydrophobicity in protein insertion?

Transmembrane segment hydrophobicity critically influences membrane protein insertion efficiency:

Research findings indicate that transmembrane segment (TMS) hydrophobicity is a key factor affecting membrane protein insertion. Experiments with SecG protein demonstrated that a single mutation (I20E) in the first transmembrane segment, which reduces hydrophobicity, significantly diminished the positive effect of YibN on protein insertion .

Side-by-side comparison of wild-type SecG and the I20E mutant showed that YibN enhanced wild-type SecG expression much more effectively than the mutant version . This pattern was observed both in co-expression experiments and in in vitro insertion assays using inverted membrane vesicles (INVs) .

These findings suggest that when troubleshooting poor expression of membrane proteins, researchers should examine the hydrophobicity profiles of transmembrane segments. Strategic modifications to increase hydrophobicity might improve membrane insertion efficiency for problematic proteins.

What in vitro assays can evaluate membrane protein insertion?

Several robust in vitro assays can quantitatively assess membrane protein insertion:

The search results describe a well-established in vitro translation/insertion assay using inverted membrane vesicles (INVs) . The protocol involves:

  • Preparing INVs from bacterial cultures expressing proteins of interest

  • Setting up a reaction mixture containing:

    • A reconstituted translation system

    • INVs (0.5 mg protein/mL)

    • Plasmid DNA encoding the substrate proteins

    • Radiolabeled amino acids ([35S] methionine and cysteine)

    • Additional components as needed (e.g., SecA at 60 μg/mL for SecG insertion)

  • Adding INVs 10 minutes after starting the reaction

  • Allowing the translation/insertion to proceed at 25°C for 90 minutes

  • Treating samples with proteinase K to generate membrane-protected fragments (MPFs)

  • Analyzing results by SDS-PAGE and autoradiography

  • Quantifying band intensity using phosphorimaging software

This assay provides quantitative data on insertion efficiency, allowing comparisons between different experimental conditions. For example, INVs enriched with YibN showed 1.5-1.8-fold stimulation of insertion for substrates like Pf3 coat, M13 procoat H5, and F0c proteins compared to control INVs .

How can researchers quantitatively assess membrane protein functionality?

Functional assays should be tailored to the specific biological activity of the membrane protein:

While the specific function of yiaB is not detailed in the search results, the principles applied to other membrane proteins can be adapted. For proteins like CyoB and CydB (terminal oxidases), functional assays confirmed that increased expression led to improved phenotypic function .

For quantitative functional assessment, consider:

  • Activity assays specific to protein function: For transporters, measure substrate transport rates; for enzymes, assess catalytic activity; for receptors, evaluate ligand binding.

  • Growth-based phenotypic assays: If the protein confers a specific growth advantage under certain conditions, growth rate or survival analysis can serve as a functional readout.

  • Complementation assays: Express the protein in knockout strains lacking the endogenous protein and measure restoration of function.

  • Multi-dimensional data analysis: For complex functional datasets, Amplitude's Data Tables enable multi-metric, multi-dimensional analyses in a single view, allowing researchers to break down events and metrics by multiple properties simultaneously .

What analytical methods can characterize membrane protein topology and structure?

Multiple complementary techniques provide insights into membrane protein topology and structure:

To determine membrane protein topology (orientation in the membrane):

  • Protease protection assays: Treat intact membranes or inverted membrane vesicles with proteases like proteinase K to identify which protein domains are protected by the membrane.

  • Reporter fusion analysis: Create fusions with reporters like GFP or alkaline phosphatase at different positions to determine which domains are exposed to different cellular compartments.

  • Cysteine accessibility methods: Introduce cysteine residues at various positions and assess their accessibility to membrane-impermeable sulfhydryl reagents.

For structural characterization:

  • Blue-native PAGE: This technique preserves native protein complexes and can reveal oligomeric states and complex formation, as demonstrated for the YidC-YibN complex .

  • Crosslinking studies: Chemical crosslinking can capture transient protein-protein interactions and provide insights into structural arrangements.

  • Advanced structural biology techniques: While not explicitly mentioned in the search results, techniques like cryo-electron microscopy, X-ray crystallography, and NMR spectroscopy provide high-resolution structural information when applicable.

How can genomic screening identify host factors affecting membrane protein expression?

Systematic genomic screening approaches can uncover host factors influencing membrane protein expression:

The search results describe a powerful approach using transposon mutagenesis to identify genetic factors that influence membrane protein expression. Researchers utilized a comprehensive transposon library in E. coli BW25113 consisting of approximately 150,000 unique transposon insertion strains to screen for genetic alterations that reduce the burden of plasmid-borne membrane protein expression .

This systematic screening approach:

  • Used GFP intensity as a proxy for increased protein expression

  • Interrogated five different inner membrane protein complexes with distinct functions

  • Identified gene disruptions that increased membrane protein expression

  • Verified overexpression in candidate transposon mutants by evaluating expression in single-gene deletion knockout mutants

  • Demonstrated improved functional expression of protein complexes in the identified deletion backgrounds

This methodology provides a framework for identifying host genetic factors that can be modified to enhance expression of specific membrane proteins. Similar approaches could be applied to optimize expression of other challenging membrane proteins.

What data analysis techniques help optimize multi-parameter membrane protein expression?

Advanced data analysis approaches can identify optimal conditions across multiple parameters:

When optimizing membrane protein expression, researchers must analyze the effects of multiple variables (temperature, induction timing, media composition, etc.) simultaneously. Multi-dimensional analysis tools can help interpret complex datasets:

Amplitude's Data Tables enable multi-metric, multi-dimensional analyses in a single view, allowing researchers to:

  • Add multiple events or metrics for simultaneous analysis

  • Break down events and metrics by property values (e.g., country, platform, week)

  • Run group-by analyses on up to five top-level properties in a single Data Table

  • Perform secondary group-by analyses nested within primary groupings

  • Apply formula metrics to grouped data for more complex analyses

For example, researchers could analyze protein expression levels grouped by induction temperature, then perform a secondary grouping by induction time, revealing optimal combinations of conditions that might be missed in single-parameter optimization approaches.

How can researchers systematically troubleshoot poor membrane protein expression?

A structured troubleshooting approach can identify and address factors limiting membrane protein expression:

Based on the search results, a systematic troubleshooting workflow might include:

  • Genetic screening: Utilize transposon mutagenesis or targeted gene deletion approaches to identify host genetic factors that may improve expression of your specific membrane protein .

  • Co-expression strategies: Test co-expression with proteins known to enhance membrane protein insertion, such as YibN for YidC substrates. For example, co-expression with YibN significantly increased production of M13 procoat, Pf3 coat proteins, F0c, and SecG .

  • Protein engineering: Analyze the hydrophobicity of transmembrane segments and consider modifications to enhance membrane insertion. The research demonstrated that reducing transmembrane segment hydrophobicity (I20E mutation in SecG) decreased insertion efficiency .

  • Membrane composition analysis: Consider that overexpression of certain proteins (like YibN) can stimulate membrane lipid production and alter membrane structure, potentially creating a more favorable environment for membrane protein insertion .

  • In vitro validation: Use inverted membrane vesicle (INV) assays to directly compare insertion efficiency under different conditions, providing quantitative data on the effectiveness of various optimization strategies .

Data Table: Comparison of Experimental Conditions for Membrane Protein Expression

ParameterStandard ConditionsOptimized Conditions with YibN Co-expressionEffect on Expression
Growth Temperature37°C25°C or room temperatureLower temperature reduces cellular stress and improves proper folding
YibN InductionN/A0.1% arabinose for 15 minutes prior to target protein inductionPrepares cellular machinery for membrane protein insertion
Target Protein Induction0.75 mM IPTG0.75 mM IPTG after YibN pre-inductionSequential induction improves expression yields
Membrane Lipid ContentBaseline levels~4-fold increase with YibN overexpressionEnhanced membrane capacity for protein insertion
Expression DurationVariable1.5-2 hours post-inductionOptimized window before toxicity effects
Expression Enhancement for YidC SubstratesBaseline1.5-1.8 fold increaseQuantifiable improvement in protein yields
SecG Wild-type ExpressionBaselineSignificantly increasedDemonstrates benefit for multi-pass membrane proteins
SecG I20E Mutant ExpressionBaselineMinimal increaseShows importance of TMS hydrophobicity

This data table summarizes key parameters for membrane protein expression optimization based on the research findings with YibN co-expression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.