Recombinant Escherichia coli Inner membrane protein yiaV (yiaV)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yiaV; b3586; JW3558; Inner membrane protein YiaV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-378
Protein Length
Full Length of Mature Protein
Species
Escherichia coli (strain K12)
Target Names
yiaV
Target Protein Sequence
MFKIFKIPVNKWTIPTAALGGIFIVSGLILLMNYNHPYTFKAQKAVISIPVVPQVTGVVI EVTDKKNTLIKKGEVLFRLDPTRYQARVDRLMADIVTAEHKQRALGAELDEMAANTQQAK ATRDKFAKEYQRYARGSQAKVNPFSERDIDVARQNYLAQEASVKSSAAEQKQIQSQLDSL VLGEHSQIASLKAQLAEAKYNLEQTIVRAPSDGYVTQVLIRPGTYAASLPLRPVMVFIPD QKRQIVAQFRQNSLLRLAPGDDAEVVFNALPGKVFSGKLAAISPAVPGGAYQSTGTLQTL NTAPGSDGVIATIELDEHTDLSALPDGIYAQVAVYSDHFSHVSVMRKVLLRMTSWVHYLY LDH
Uniprot No.

Target Background

Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant E. coli YiaV production?

Several expression systems can be utilized for YiaV production, with varying efficacy depending on your research goals:

For YiaV expression, the Sec translocase and YidC insertion pathways are typically involved in E. coli inner membrane protein integration. The Sec translocase, comprised of the SecYEG complex, forms a pore in the inner membrane and is required for most proteins. YidC can function both in association with the Sec-translocon and independently .

Recommended expression systems:

  • T7 RNA polymerase-based systems (pET vectors) with careful selection of promoter strength

  • Arabinose-inducible systems (pBAD vectors) for titratable expression

  • Rhamnose-inducible systems for Lemo21(DE3) strains

Expression strain considerations:

StrainFeaturesBest forTemperature
C41(DE3)/C43(DE3)Mutations in lacUV5 promoterToxic membrane proteins18-37°C
Lemo21(DE3)Tunable T7 lysozymeMembrane proteins30°C
Arctic Express (DE3)Cold-adapted chaperoninsDifficult-to-fold proteins11°C
SuptoxR strainsRraA overexpressionSuppression of toxicityVarious

SuptoxR2.1 and SuptoxR2.2 strains with RraA proteins from P. mirabilis and P. stuartii have shown improved membrane protein production compared to original SuptoxR strains .

How do membrane localization pathways affect YiaV expression and functionality?

YiaV, like other E. coli inner membrane proteins, relies on specific machinery for proper membrane integration:

The choice of membrane insertion pathway significantly impacts recombinant YiaV expression. In E. coli, two major membrane insertion systems are characterized: the Sec translocase and YidC insertase . Research has demonstrated that small membrane proteins, which YiaV likely resembles, can use varied insertion mechanisms that may involve both pathways .

While YidC traditionally inserts fewer substrates than Sec, it plays a crucial role in quality control during insertion, which affects functional expression. Mutations in YidC (such as T362I) can significantly enhance functional expression of recombinant membrane proteins by altering quality control mechanisms .

For optimal YiaV expression:

  • Consider co-expression with modified YidC variants

  • Explore secretion via the Sec-dependent pathway using signal peptides like PelB or DsbA

  • Investigate SRP-dependent co-translational translocation by fusing appropriate signal sequences

Methodology for pathway determination includes in vivo depletion studies of SecE and YidC to determine pathway dependencies for your specific construct .

What are the most common challenges in expressing functional YiaV and how can they be addressed?

Expressing membrane proteins like YiaV presents several challenges:

Major challenges and solutions:

  • Toxicity to host cells:

    • Use specialized strains like C41(DE3)/C43(DE3) with mutations in the lacUV5 promoter that weaken T7 RNA polymerase expression

    • Employ SuptoxR strains that co-express RraA to suppress toxicity and enhance properly folded membrane protein accumulation

    • Utilize tightly controlled expression systems with titratable inducers

  • Improper membrane integration:

    • YidC mutations can dramatically improve functional expression by correcting mismatches in membrane topogenic signals

    • Consider combinatorial approaches like YidC T362I mutation with HslV protease inactivation

  • Protein misfolding:

    • Lower expression temperature (11-18°C) to slow folding kinetics

    • Co-express chaperones that assist membrane protein folding

    • Use Arctic Express strains containing cold-adapted chaperonins

  • Low yield:

    • Optimize media composition and induction parameters using multivariate experimental design approaches

    • Screen multiple E. coli strains in parallel for optimal expression

    • Test different fusion tags and their positions (N- vs C-terminal)

Strains with modified membrane protein assembly machinery, particularly YidC variants, have shown dramatic improvements in functional expression of challenging membrane proteins .

What experimental design methodologies are recommended for optimizing YiaV expression?

A systematic experimental design approach is essential for optimizing YiaV expression:

Multivariate analysis methodology:
Rather than the traditional univariate approach (changing one variable at a time), employ multivariate methods that evaluate responses by changing multiple variables simultaneously . This approach:

  • Estimates statistically significant variables

  • Accounts for interactions between variables

  • Characterizes experimental error

  • Compares effects when variables are normalized

  • Gathers high-quality information with fewer experiments

Recommended experimental design:

  • Define critical parameters: Inducer concentration, temperature, media composition, host strain, and duration

  • Design factorial experiments: Use 2^k factorial or fractional factorial designs

  • Analyze variance: Apply ANOVA to identify significant factors and interactions

  • Response surface methodology: Optimize identified significant variables

  • Confirmation experiments: Validate optimized conditions

Example optimization strategy:

ParameterLevels to testOptimization goal
IPTG concentration0.1-1.0 mMBalance expression and toxicity
Post-induction temperature11°C, 18°C, 30°CImprove folding
Media supplementsVarious ions, glycerol, amino acidsEnhance stability
Induction OD6000.5-1.0Maximize cell density before toxicity

To increase statistical power, ensure adequate sample size and control for confounding variables that can throw off your results . Small-scale screens in 2-ml tubes or 96-well plates can be performed before scale-up to test multiple conditions efficiently .

How can YidC-mediated membrane integration be manipulated to improve YiaV expression?

YidC plays a critical role in membrane protein insertion that can be leveraged for YiaV expression:

YidC is a bacterial insertase that assists in the integration, folding, and assembly of inner membrane proteins both in association with the Sec-translocon and independently . Research has identified specific mutations in YidC that dramatically enhance expression of recombinant membrane proteins.

Key YidC manipulation strategies:

  • Introduce specific YidC mutations: The T362I mutation in YidC has been shown to enhance functional expression of recombinant membrane proteins by altering quality control mechanisms

  • Combine with protease inactivation: Inactivation of HslV protease (through C160Y mutation) synergistically enhances membrane protein expression when combined with YidC T362I

  • Consider YidD co-expression: YidD, which overlaps with rnpA and is located just 2 bp upstream of yidC, has been shown to be involved in the efficient insertion and maturation of YidC-dependent inner membrane proteins

Experimental evidence suggests that YidC may play a role in quality control of membrane proteins at the insertion level. Alteration of this function through specific mutations can greatly enhance functional overexpression . These approaches may be particularly effective for membrane proteins like YiaV that exhibit violations of the positive-inside rule or have decreased transmembrane helix hydrophobicity .

How should researchers approach functional characterization of poorly understood membrane proteins like YiaV?

For understudied membrane proteins like YiaV, a systematic functional characterization approach is essential:

Methodological framework:

  • Bioinformatic analysis:

    • Conduct sequence homology searches against characterized proteins

    • Perform operon analysis to identify associated genes and potential functional pathways

    • Predict transmembrane domains and topology using algorithms like TMHMM, Phobius, or TOPCONS

  • Gene disruption and complementation:

    • Generate a knockout strain using techniques like the one demonstrated for yiaE

    • Introduce a kanamycin resistance gene in the middle of the target gene

    • Confirm disruption through PCR and phenotypic analysis

    • Perform complementation studies with plasmid-expressed YiaV

  • Growth phenotype characterization:

    • Test growth on various carbon sources and under different stress conditions

    • Compare wild-type and knockout strains to identify conditions where YiaV is essential

    • Use phenotype microarrays for high-throughput screening of growth conditions

  • Protein-protein interaction studies:

    • Perform co-immunoprecipitation experiments with tagged YiaV

    • Use bacterial two-hybrid systems to identify interaction partners

    • Apply chemical cross-linking followed by mass spectrometry

  • Transcriptional profiling:

    • Analyze expression patterns under different growth conditions

    • Determine if expression is constitutive or induced by specific conditions, as was done for yiaE

The yiaE gene study provides a methodological template—it was found to be constitutively expressed in E. coli with slightly higher activity in the presence of D-glucose or D-gluconate .

What purification strategies are most effective for recombinant YiaV?

Purification of membrane proteins like YiaV requires specialized approaches:

Comprehensive purification workflow:

  • Membrane isolation:

    • Harvest cells and disrupt by sonication or French press

    • Remove unbroken cells and debris by low-speed centrifugation (10,000 × g)

    • Collect membrane fraction by ultracentrifugation (100,000 × g)

    • Wash membranes to remove peripheral proteins

  • Solubilization screening:

    • Test multiple detergents in parallel:

      • Mild detergents: DDM, LMNG, or digitonin for functional studies

      • Stronger detergents: SDS or Triton X-100 for denatured protein

    • Optimize detergent concentration, temperature, and duration

    • Verify solubilization by centrifugation and SDS-PAGE analysis

  • Affinity purification:

    • Express YiaV with appropriate affinity tags (His-tag recommended)

    • Use metal-chelate affinity chromatography with Ni-NTA or TALON resin

    • Include detergent in all buffers above critical micelle concentration

    • Consider on-column detergent exchange

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

    • Assess protein homogeneity by SDS-PAGE and Western blotting

Based on approaches used for other E. coli membrane proteins, His-tagged constructs purified by metal-chelate affinity chromatography have proven effective, as demonstrated in the yiaE study . For crystallization purposes, consider detergent screening and stability assays to identify conditions that maintain YiaV in a stable, monodisperse state.

How can experimental variability be controlled when working with YiaV expression systems?

Controlling variability is critical for reproducible YiaV expression studies:

Sources of variability and control methods:

  • Statistical considerations:

    • Variability affects the ability to detect treatment effects, similar to distinguishing radio signals from static

    • Two factors are involved in assessing experimental variables: a measure of centrality (mean, median) and a measure of variability (standard deviation)

    • While you have limited control over centrality measures, variability can be controlled through proper experimental design

  • Biological sources of variation:

    • Clone-to-clone variation in expression

    • Metabolic burden effects

    • Plasmid stability differences

    • Cell growth phase inconsistencies

  • Technical sources of variation:

    • Inducer concentration differences

    • Media batch variations

    • Temperature fluctuations

    • Aeration inconsistencies

Methodological approaches to reduce variability:

  • Select reliable dependent variables

  • Provide uniform instructions and standardized procedures

  • Control obtrusive and extraneous experimental stimuli

  • Include positive and negative controls in each experiment

  • Measure growth curves and protein expression kinetics

  • Use technical and biological replicates (minimum n=3)

  • Maintain consistent cell disruption methods

When analyzing results, use appropriate statistical tests and present both measures of central tendency and variability. Standard deviation is preferred for interval or ratio scale measurements and conceptually represents "on average, how far scores are from the mean" .

What strategies can resolve membrane protein misfolding issues during YiaV expression?

Membrane protein misfolding is a common challenge that requires systematic troubleshooting:

Comprehensive misfolding resolution strategies:

  • Strain engineering approaches:

    • Use C41(DE3)/C43(DE3) strains with mutations that weaken T7 RNAP expression

    • Consider SuptoxR strains that co-express RraA to enhance properly folded membrane protein accumulation

    • Test SuptoxR2.1 and SuptoxR2.2 with RraA variants from P. mirabilis and P. stuartii

    • Explore strains with modified membrane protein quality control systems like YidC T362I with HslV C160Y

  • Expression condition optimization:

    • Lower temperature to slow folding kinetics (11-18°C)

    • Reduce inducer concentration for slower expression

    • Test different media formulations

    • Consider auto-induction systems for gradual protein production

  • Genetic construct modifications:

    • Test different fusion partners that enhance folding

    • Optimize codon usage for E. coli

    • Consider truncation constructs to remove problematic domains

    • Introduce stabilizing mutations identified through directed evolution

  • Chaperone co-expression:

    • Co-express membrane protein-specific chaperones

    • Use strains with enhanced chaperone systems like Arctic Express

  • Post-expression approaches:

    • Include stabilizing ligands during extraction

    • Test various detergents for optimal solubilization

    • Use protein quality control assays to monitor folding status

Most small membrane proteins utilize diverse membrane insertion mechanisms that can be exploited for improved expression . YidC has been identified as a factor that assists in the integration, folding, and assembly of inner membrane proteins , making it a key target for optimization.

How can advanced experimental design approaches improve YiaV characterization?

Sophisticated experimental design techniques can significantly enhance YiaV research:

Advanced design methodologies:

When designing YiaV experiments, consider that inner membrane proteins may follow different biogenesis pathways that affect expression and functionality . Statistical power analysis should be performed before experiments to determine appropriate sample sizes for detecting expected effects .

Author's Notes

This FAQ collection was compiled based on academic research literature on E. coli inner membrane proteins, with particular attention to methodological approaches relevant to YiaV study. While specific information on YiaV itself is limited in the current literature, the approaches described here reflect best practices for characterizing and working with similar membrane proteins in E. coli expression systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.