Recombinant Escherichia coli Inner membrane protein yibH (yibH)

Shipped with Ice Packs
In Stock

Description

Molecular and Genetic Features

The yibH gene (locus tags: b3597, JW3571, ECK3586) encodes a 378-amino-acid protein with a predicted molecular weight of approximately 42 kDa . Key genetic and structural details include:

FeatureDescription
Gene NameyibH
UniProt IDP0AFV0 (strain K12); P0AFV1 (O157:H7)
Host SystemsE. coli, yeast, baculovirus, mammalian cells, or cell-free expression systems
Purity≥85–90% (determined by SDS-PAGE)
SequenceFull-length (1-378 aa), with His-tag variants for purification

The protein features a hydrophobic transmembrane domain consistent with its inner membrane localization and putative role in efflux pump complexes .

Functional Roles and Interaction Network

YibH is hypothesized to function as a membrane fusion protein (MFP) component of tripartite efflux pumps, which mediate resistance to antimicrobial agents and cellular detoxification . STRING interaction data highlight its association with:

Interaction PartnerFunctionScore
yibIDUF3302 family inner membrane protein0.810
macBMacrolide ABC transporter ATPase/permease0.708
cusCOuter membrane component of copper/silver efflux systems0.641
rsxESoxR iron-sulfur cluster reduction factor0.600

These interactions suggest YibH participates in transenvelope complexes that coordinate substrate transport across the inner membrane, periplasm, and outer membrane . A recent study proposed that YdbH (a homolog) forms an intermembrane bridge with lipoprotein YnbE to facilitate phospholipid transport, hinting at a broader role for YibH-like proteins in lipid homeostasis .

Recombinant Production and Applications

Recombinant YibH is produced in multiple systems, with protocols optimized for high yield and purity:

Expression and Purification

  • Hosts: E. coli (most common), yeast, baculovirus, or mammalian cells .

  • Purification: Affinity chromatography (e.g., His-tag) .

  • Storage: Lyophilized or in Tris/PBS buffers with trehalose or glycerol at -20°C/-80°C .

Research Applications

  • Antigen Production: Used to generate polyclonal antibodies for ELISA and Western blotting .

  • Structural Studies: Full-length variants enable crystallography or NMR to resolve membrane protein dynamics .

  • Efflux Pump Characterization: Functional assays to study antibiotic resistance mechanisms .

Ongoing Research and Implications

Recent studies emphasize YibH’s potential role in outer membrane biogenesis and stress response . Its homology to eukaryotic lipid-transfer proteins underscores its utility as a model for studying conserved membrane transport mechanisms . Future research may explore its regulatory interactions with transcription factors like FNR or ArcA, which modulate efflux pump expression under anaerobic conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the product is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
yibH; b3597; JW3571; Inner membrane protein YibH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yibH
Target Protein Sequence
MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKA VIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTL RAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKG SVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTY AAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPV VPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVM RKVLLRMTSWMHYLYLDH
Uniprot No.

Target Background

Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of E. coli inner membrane protein yibH?

E. coli inner membrane protein yibH is a transmembrane protein comprising 378 amino acids with a molecular structure characterized by multiple membrane-spanning domains. The full amino acid sequence is:

MDLLIVLTYVALAWAVFKIFRIPVNQWTLATAALGGVFLVSGLILLMNYNHPYTFTAQKAVIAIPITPQVTGIVTEVTDKNNQLIQKGEVLFKLDPVRYQARVDRLQADLMTATHNIKTLRAQLTEAQANTTQVSAERDRLFKNYQRYLKGSQAAVNPFSERDIDDARQNFLAQDALVKGSVAEQAQIQSQLDSMVNGEQSQIVSLRAQLTEAKYNLEQTVIRAPSNGYVTQVLIRPGTYAAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDDAEVVFNALPGQVFHGKLTSILPVVPGGSYQAQGVLQSLTVVPGTDGVLGTIELDPNDDIDALPDGIYAQVAVYSDHFSHVSVMRKVLLRMTSWMHYLYLDH

The membrane-spanning regions are critical for its localization and function within the bacterial inner membrane. Analysis of its hydrophobicity profile indicates the presence of several transmembrane helices that anchor the protein within the lipid bilayer.

What expression systems are optimal for producing recombinant yibH protein?

For successful expression of recombinant yibH, E. coli expression systems remain the gold standard due to several methodological advantages. The protein has been successfully expressed in E. coli with an N-terminal His-tag for purification purposes . When expressing this membrane protein, researchers should consider:

  • Using specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

  • Optimizing induction conditions (lower temperatures of 16-25°C often improve proper folding)

  • Using specific detergents for solubilization (n-dodecyl-β-D-maltoside or LDAO)

  • Applying controlled expression rates to prevent toxicity and inclusion body formation

For higher yields, a dual-plasmid system incorporating both the target gene and chaperone proteins may increase proper folding efficiency, particularly when expression yields are initially low.

How is yibH protein localization confirmed in experimental settings?

Confirmation of yibH localization to the inner membrane requires a multi-faceted approach:

  • Subcellular fractionation: Separate inner and outer membranes using sucrose gradient ultracentrifugation, followed by Western blot analysis using anti-His antibodies for tagged recombinant yibH .

  • Fluorescence microscopy: Create GFP-yibH fusion proteins to visualize membrane localization patterns.

  • Protease accessibility assays: Determine topology by exposing intact cells, spheroplasts, and membrane vesicles to proteases.

  • Immunogold electron microscopy: Provides nanometer-scale resolution of protein localization within membrane structures.

The experimental approach mirrors methods used with other inner membrane proteins like YidC, which is involved in membrane protein insertion and folding in bacteria . The presence of amphipathic helices in membrane proteins like YidD (which has similar localization patterns) offers structural elements that facilitate membrane association .

What are the critical storage conditions for maintaining recombinant yibH stability?

Proper storage of recombinant yibH is essential for maintaining its structural integrity and functionality. Based on standard protocols for membrane proteins:

The lyophilized recombinant yibH protein should be stored at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use cases. The recommended storage buffer consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute protein in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Aliquot the solution to avoid repeated freeze-thaw cycles, which significantly reduce protein stability and activity

Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as membrane proteins are particularly susceptible to denaturation during these processes .

How can researchers troubleshoot poor expression yields of recombinant yibH?

When encountering low expression yields of recombinant yibH, researchers should systematically evaluate:

  • Expression strain optimization:

    • Test multiple E. coli strains specifically engineered for membrane proteins

    • Consider strains with reduced protease activity (BL21, Rosetta)

  • Induction parameters:

    • Reduce IPTG concentration (0.1-0.5 mM instead of 1 mM)

    • Lower induction temperature (16-25°C)

    • Extend induction time (overnight instead of 3-4 hours)

  • Expression construct design:

    • Optimize codon usage for E. coli

    • Try different fusion tags (His-tag position can affect folding)

    • Consider adding fusion partners that enhance solubility

  • Growth media adjustments:

    • Use enriched media like Terrific Broth

    • Add membrane-stabilizing components like glycerol (0.5-2%)

    • Supplement with specific ions that might facilitate proper folding

This systematic approach parallels methods used successfully for other E. coli membrane proteins in the literature, where expression optimization has been critical for structural and functional studies.

What purification strategy offers the highest purity for recombinant His-tagged yibH?

For optimal purification of His-tagged yibH, a multi-step chromatography approach is recommended:

  • Initial membrane preparation:

    • Harvest E. coli cells expressing yibH by centrifugation

    • Lyse cells using a combination of enzymatic (lysozyme) and mechanical (sonication) methods

    • Isolate membrane fraction through ultracentrifugation (100,000×g, 1 hour)

  • Membrane protein solubilization:

    • Solubilize membranes in buffer containing appropriate detergent (n-dodecyl-β-D-maltoside at 1-2% is typically effective)

    • Incubate with gentle agitation at 4°C for 1-2 hours

    • Remove insoluble material by ultracentrifugation

  • Immobilized metal affinity chromatography (IMAC):

    • Apply solubilized membrane proteins to Ni-NTA resin

    • Wash extensively with buffer containing low imidazole (20-40 mM) and detergent at concentrations above its critical micelle concentration

    • Elute with buffer containing high imidazole (250-500 mM)

  • Size exclusion chromatography (SEC):

    • Apply IMAC-purified protein to SEC column

    • Collect fractions containing monomeric yibH

    • Analyze purity by SDS-PAGE (should exceed 90% purity)

This approach typically yields protein of greater than 90% purity as determined by SDS-PAGE, suitable for subsequent structural and functional studies.

How does yibH compare functionally to other E. coli inner membrane proteins like YidC?

While specific functional data for yibH remains limited in the available literature, its classification as an inner membrane protein suggests certain functional parallels with better-characterized inner membrane proteins like YidC:

  • Membrane insertion machinery participation:

    • YidC plays an essential role in membrane protein insertion and folding in bacteria

    • Like YidC, yibH may participate in protein translocation processes based on structural similarities

    • The conservation of membrane proteins within gene clusters suggests functional relationships

  • Potential involvement in protein quality control:

    • YidC has been copurified with membrane protease FtsH and modulator proteins HflK/HflC, suggesting an early role in quality control of membrane proteins

    • yibH might participate in similar quality control networks, potentially assisting in the proper folding or degradation of misfolded proteins

  • Genomic context considerations:

    • YidC is located within a highly conserved gene cluster (rpmH, rnpA, yidD, yidC, trmE) involved in protein synthesis and membrane targeting

    • Analysis of yibH's genomic neighborhood could provide insights into its potential functional role in related cellular processes

The functional characterization of membrane proteins often involves comparative analysis with better-studied family members, creating a framework for understanding potential roles even when direct experimental evidence is limited.

What experimental approaches can determine if yibH interacts with the Sec translocon?

To investigate potential interactions between yibH and the Sec translocon, researchers should implement multiple complementary approaches:

  • In vivo crosslinking:

    • Use chemical crosslinkers like DSP or photo-activatable crosslinkers

    • Perform immunoprecipitation with anti-yibH antibodies

    • Identify interacting partners by mass spectrometry

    • Look specifically for Sec translocon components (SecY, SecE, SecG)

This approach parallels methods used to demonstrate that YidD is in proximity to nascent inner membrane proteins during localization in the Sec-YidC translocon .

  • Bacterial two-hybrid assays:

    • Create fusion constructs of yibH and Sec components

    • Screen for positive interactions in reporter strains

    • Validate interactions using deletion and point mutations

  • Ribosome nascent chain complex (RNC) analysis:

    • Generate stalled RNCs of yibH

    • Purify complexes and analyze for association with Sec components

    • Use cryo-electron microscopy to visualize potential interactions

  • Depletion studies:

    • Create conditional depletion strains for Sec components

    • Assess effects on yibH insertion and localization

    • Quantify membrane integration efficiency using protease protection assays

Similar approaches have revealed that YidC can function both in cooperation with and independently of the Sec translocon for different substrate proteins , providing methodological precedent for yibH characterization.

How might structure-function relationships in yibH be investigated using mutagenesis approaches?

Structure-function analysis of yibH can be systematically pursued through targeted mutagenesis strategies:

  • Transmembrane domain scanning mutagenesis:

    • Create alanine substitutions throughout predicted transmembrane segments

    • Assess effects on membrane integration, stability, and function

    • Identify residues critical for structural integrity versus functional activity

  • Charge substitution analysis:

    • Introduce charged residues (Arg, Lys, Glu, Asp) at specific positions

    • Evaluate topological disruptions using reporter fusions (PhoA, GFP)

    • Determine membrane topology constraints and important electrostatic interactions

  • Conserved motif targeting:

    • Identify highly conserved sequences across yibH homologs

    • Create targeted mutations in these regions

    • Assess functional consequences using complementation assays in deletion strains

  • Domain swapping experiments:

    • Exchange domains between yibH and related proteins

    • Create chimeric constructs

    • Determine which regions confer specific functional properties

These approaches have been productively applied to other membrane proteins, including YidC, where structure-function relationships have been elucidated through systematic mutational analysis of conserved residues and domains .

What high-resolution structural determination methods are most promising for yibH characterization?

For high-resolution structural studies of yibH, researchers should consider these advanced methodological approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Increasingly the method of choice for membrane proteins

    • Can resolve structures to 2-3 Å resolution

    • Requires purification in detergent micelles or nanodiscs

    • Minimal sample requirements compared to crystallography

  • X-ray crystallography:

    • Requires highly pure, homogenous, and stable protein preparations

    • Lipidic cubic phase (LCP) crystallization particularly suited for membrane proteins

    • Screen multiple detergents and crystallization conditions systematically

    • Consider fusion partners (T4 lysozyme, BRIL) to enhance crystallization propensity

  • NMR spectroscopy:

    • Suitable for smaller membrane protein domains or fragments

    • Provides dynamic information not available from static methods

    • Requires isotopic labeling (13C, 15N) in minimal media

    • Can determine membrane topology and lipid interactions

  • Integrative structural biology:

    • Combine lower-resolution techniques (SAXS, EM) with computational modeling

    • Use crosslinking-mass spectrometry data to constrain models

    • Incorporate evolutionary covariance data for contact prediction

    • Validate models with site-directed mutagenesis

These approaches have revolutionized structural studies of membrane proteins like YidC, providing insights into their mechanisms of action and interaction networks .

How can researchers investigate potential roles of yibH in antimicrobial resistance mechanisms?

To explore yibH's potential involvement in antimicrobial resistance, implement this systematic research strategy:

  • Gene deletion and overexpression studies:

    • Create ΔyibH knockout strains and yibH-overexpressing strains

    • Determine minimum inhibitory concentrations (MICs) for diverse antibiotics

    • Look for class-specific effects suggesting mechanism involvement

    • Compare results with knockouts of known resistance determinants

  • Transcriptomic and proteomic analysis:

    • Analyze expression changes in response to antibiotic stress

    • Compare wild-type vs. ΔyibH strains under antibiotic challenge

    • Identify coordinated expression with known resistance factors

    • Correlate with physiological and phenotypic observations

  • Membrane permeability assays:

    • Measure uptake of fluorescent dyes (propidium iodide, NPN)

    • Monitor leakage of cellular contents (ATP, proteins)

    • Assess lipopolysaccharide modifications and outer membrane protein changes

    • Determine if yibH affects envelope integrity under antibiotic stress

  • Protein-antibiotic interaction studies:

    • Perform drug binding assays with purified yibH

    • Use thermal shift assays to detect stabilization upon antibiotic binding

    • Investigate direct drug efflux or sequestration capabilities

    • Consider surface plasmon resonance for binding kinetics

This methodological framework parallels approaches used to characterize other membrane proteins with roles in antimicrobial resistance, providing a systematic pathway for yibH functional characterization.

What methods can assess potential interactions between yibH and other membrane protein complexes?

To comprehensively characterize yibH's interaction network within membrane protein complexes:

  • Blue native-PAGE and complexome profiling:

    • Solubilize membrane preparations in mild detergents

    • Separate native complexes by blue native-PAGE

    • Excise gel bands and analyze by mass spectrometry

    • Create migration profiles to identify co-migrating proteins

  • Co-immunoprecipitation with quantitative proteomics:

    • Express tagged yibH in E. coli

    • Perform pull-downs under varying detergent conditions

    • Identify interacting partners by LC-MS/MS

    • Use SILAC or TMT labeling for quantitative comparison between conditions

  • Proximity-dependent labeling:

    • Create BioID or APEX2 fusions with yibH

    • Express in E. coli and activate labeling

    • Identify biotinylated proteins by streptavidin purification and MS

    • This approach captures even transient interactions in the native environment

  • FRET-based interaction mapping:

    • Create fluorescent protein fusions with yibH and candidate partners

    • Measure FRET efficiency in live cells

    • Use acceptor photobleaching to confirm specific interactions

    • Apply spectral imaging to resolve complex interaction networks

Similar approaches have revealed that YidC interacts with the membrane protease FtsH and modulator proteins HflK/HflC , suggesting methodology that could be productive for yibH characterization.

How can contradictory data about yibH function be reconciled in the scientific literature?

When confronted with contradictory experimental results regarding yibH function, researchers should apply these methodological approaches:

  • Systematic analysis of experimental conditions:

    • Create a comprehensive table comparing key experimental parameters across studies

    • Identify variations in strain backgrounds, growth conditions, and assay methodologies

    • Test whether these variations explain discrepancies through controlled experiments

    • Standardize protocols to enhance reproducibility

  • Genetic background considerations:

    • Verify genetic backgrounds of strains used in different studies

    • Evaluate the presence of suppressor mutations that might mask phenotypes

    • Recreate key experiments in identical genetic backgrounds

    • Consider strain-specific effects and their biological significance

  • Functional redundancy assessment:

    • Identify potential paralogs or functionally redundant proteins

    • Create combination knockouts to reveal masked phenotypes

    • Test for condition-specific functional requirements

    • Evaluate evolutionary conservation patterns for functional predictions

  • Integrative data analysis:

    • Apply meta-analysis techniques to quantitatively compare results across studies

    • Weight evidence based on methodological rigor and reproducibility

    • Consider Bayesian approaches to estimate confidence in various functional models

    • Develop testable hypotheses that could resolve apparent contradictions

This systematic approach parallels methods used to resolve contradictory data for other membrane proteins, where experimental conditions and genetic backgrounds often explain apparent discrepancies in the literature.

What emerging technologies will advance understanding of yibH's role in bacterial physiology?

Cutting-edge technologies poised to revolutionize our understanding of yibH include:

  • CryoET and subtomogram averaging:

    • Visualize yibH in its native membrane environment

    • Resolve interactions with other complexes at 10-20Å resolution

    • Identify structural changes under different physiological conditions

    • Map spatial distribution within the bacterial cell

  • Single-molecule tracking in live cells:

    • Create photoactivatable fluorescent protein fusions

    • Track individual molecules with super-resolution microscopy

    • Measure diffusion constants and confinement zones

    • Determine if yibH forms discrete functional complexes or distributes homogeneously

  • AlphaFold and integrative modeling:

    • Generate high-confidence structural models from sequence

    • Predict interaction interfaces with other proteins

    • Guide rational mutagenesis and functional studies

    • Integrate experimental constraints for refined models

  • CRISPR interference for conditional regulation:

    • Create CRISPRi strains for precise temporal control of yibH expression

    • Analyze acute vs. chronic depletion phenotypes

    • Perform time-resolved omics to capture primary vs. secondary effects

    • Identify condition-specific requirements for yibH function

These technologies have transformed our understanding of related membrane proteins, providing unprecedented insights into their structural dynamics and functional roles in bacterial physiology.

How might yibH research contribute to broader understanding of membrane protein evolution?

Research on yibH provides an excellent model system for investigating fundamental aspects of membrane protein evolution:

  • Comparative genomics approaches:

    • Analyze the presence, absence, and variation of yibH across bacterial species

    • Correlate with phylogenetic relationships and ecological niches

    • Identify patterns of co-evolution with interacting partners

    • Determine if horizontal gene transfer has shaped yibH distribution

  • Evolutionary rate analysis:

    • Calculate dN/dS ratios across transmembrane and loop regions

    • Identify signatures of purifying or positive selection

    • Compare evolutionary constraints with other membrane proteins

    • Correlate conservation patterns with structural features

  • Ancestral sequence reconstruction:

    • Infer ancestral yibH sequences at key evolutionary branching points

    • Express and characterize these reconstructed proteins

    • Determine how function and specificity have evolved

    • Identify key mutations that altered functional properties

  • Experimental evolution studies:

    • Subject E. coli to selection pressures relevant to yibH function

    • Sequence evolved strains to identify yibH mutations

    • Characterize functional consequences of these mutations

    • Recapitulate evolutionary trajectories in controlled settings

This research framework connects yibH studies to broader questions in evolutionary biology, potentially revealing general principles of membrane protein evolution applicable across bacterial systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.