Recombinant Escherichia coli Inner membrane protein yidH (yidH)

Shipped with Ice Packs
In Stock

Description

Introduction to Inner Membrane Proteins in E. coli

The inner membrane of Escherichia coli contains numerous proteins that perform essential functions in cellular processes including transport, energy generation, and signal transduction. Among these proteins, YidD has emerged as an interesting subject of study due to its conserved nature across bacterial species and its potential role in membrane protein insertion pathways. YidD is located in a highly conserved gene cluster in Gram-negative bacteria, with the gene order being rpmH, rnpA, yidD, yidC, and trmE . This conservation suggests an important evolutionary role for this protein in bacterial physiology.

The inner membrane of E. coli serves as a selective barrier that maintains cellular homeostasis while facilitating essential metabolic functions. Proper insertion of proteins into this membrane is critical for bacterial survival and involves complex machinery including the Sec translocon and YidC insertase. YidD appears to play a supportive role in this process, particularly for YidC-dependent membrane proteins.

Genomic Organization

The yidD gene is strategically positioned in the E. coli genome, sandwiched between rnpA (with a 37-bp overlap) and yidC (with only a 2-bp spacing) . This tight genetic arrangement is highly conserved among Gram-negative bacteria, suggesting functional significance. The gene cluster containing yidD (rpmH-rnpA-yidD-yidC-trmE) represents one of the most conserved genomic arrangements in Eubacteria and even extends to some Archaea . This remarkable conservation of gene proximity and order suggests coordinated expression and related functions among these genes.

Expression Analysis

Research has confirmed that yidD is expressed in E. coli through several experimental approaches. Reverse transcription-PCR (RT-PCR) analysis detected transcripts spanning from yidD to yidC, indicating that yidD is at least partially cotranscribed with yidC . Further expression analysis using a β-galactosidase reporter system demonstrated significant activity of a yidD-lacZ fusion compared to a promoterless lacZ control, providing additional evidence for yidD transcription and translation in E. coli .

Protein Structure

YidD belongs to a family of small proteins (approximately 80 amino acids) containing a domain of unknown function 37 (DUF37) that features three conserved cysteine residues . While the complete three-dimensional structure remains to be determined, analysis suggests that YidD contains an N-terminal region with a putative amphipathic α-helix that mediates its association with the inner membrane .

Membrane Localization

Experimental evidence indicates that YidD associates with the inner membrane of E. coli. When expressed with an N-terminal His6 tag, Western blotting revealed a 14-kDa product, which migrates more slowly than the predicted 9.4 kDa possibly due to the addition of the His tag . Interestingly, fusion of the His6 tag to the C-terminal end of yidD resulted in only faintly detectable protein, suggesting that modification of the C-terminus might destabilize the protein . This observation hints at the importance of the C-terminal region for proper folding or stability of YidD.

Role in Membrane Protein Insertion

Although YidD is not essential for E. coli viability, experimental evidence suggests it plays a role in the efficient insertion and maturation of YidC-dependent inner membrane proteins (IMPs) . Deletion of yidD affected the insertion and processing of three YidC-dependent IMPs compared to control cells, indicating a functional relationship between YidD and YidC .

Interaction with Nascent Membrane Proteins

In vitro cross-linking experiments have demonstrated that YidD is in close proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon . This finding suggests that YidD might directly participate in the membrane protein insertion process, potentially facilitating the interaction between nascent chains and YidC or helping to stabilize membrane proteins during their insertion .

Relationship to YidC

YidC is well-characterized as a protein that functions in membrane protein insertion through multiple pathways:

  1. It can operate in conjunction with the Sec translocon for certain membrane proteins

  2. It can function independently in the insertion of small membrane proteins

  3. It may act as a chaperone to assist in the folding of membrane proteins

YidD appears to support YidC's function, particularly in the insertion of YidC-dependent membrane proteins . The close genomic proximity and co-transcription of yidD and yidC further support a functional relationship between these proteins.

Conservation Across Bacterial Species

The yidD gene is widely distributed across bacterial phyla, indicating evolutionary significance . While the gene cluster containing yidD is strikingly conserved among Gram-negative bacteria, homologs of yidD are also found in Gram-positive bacteria, though with less conservation of the genomic context .

Presence in Other Organisms

Intriguingly, yidD homologs defined by the presence of the conserved DUF37 domain are found in all sequenced plant genomes but are absent in yeast, Caenorhabditis elegans, and mammals . This selective distribution across evolutionary lineages raises interesting questions about the specialized functions of YidD in different organisms. Additionally, yidD has been found in the genome of Haemophilus influenzae phage HP1, suggesting possible horizontal gene transfer events during evolution .

Gene Fusion in Reduced Genomes

A particularly compelling example of evolutionary pressure to maintain YidD function is observed in Blochmannia pennsylvanicus, an obligate intracellular symbiotic bacterium with a highly reduced genome of only 792 kb. In this organism, the yidD gene is fused to the 5' end of the yidC gene, creating a yidDC fusion . The presence of this fusion among the merely 610 identified open reading frames in this highly reduced genome strongly suggests evolutionary pressure to maintain a linked function between these two proteins .

Genetic Manipulation

Researchers have employed various techniques to study YidD, including gene deletion and complementation strategies. The construction of a ΔyidD strain according to Datsenko and Wanner methodology has been reported, where the yidD gene was replaced with a kanamycin resistance cassette . This approach allowed for the assessment of YidD's functional significance by comparing wild-type and knockout strains.

Protein Expression and Detection

For expression studies, the yidD gene has been cloned under lac promoter control in expression vectors such as pEH3 . Addition of a His6 tag, particularly at the N-terminus, has facilitated detection of the expressed protein through Western blotting. GFP fusion constructs have also been employed to visualize the localization of YidD within bacterial cells .

Cross-linking Analysis

In vitro sulfhydryl cross-linking approaches have been used to identify proteins in proximity to nascent inner membrane proteins during their insertion. Such techniques revealed that YidD is in close proximity to nascent membrane proteins that are also near YidC, supporting a direct role for YidD in membrane protein biogenesis .

Potential Applications in Recombinant Protein Production

Understanding the role of YidD in membrane protein insertion could have practical applications in biotechnology, particularly for the production of recombinant membrane proteins. Membrane proteins are notoriously difficult to express in recombinant systems, and insights into the natural machinery involved in their insertion might lead to improved expression strategies.

Unanswered Questions

Several questions remain regarding YidD function:

  1. The precise mechanism by which YidD assists in membrane protein insertion

  2. The structural basis for YidD interaction with nascent membrane proteins

  3. The evolutionary significance of YidD conservation in plants but not in animals

  4. The potential role of YidD in quality control of membrane proteins

Comparison to Other Membrane Protein Biogenesis Factors

While YidD appears to function in conjunction with YidC, its role is clearly distinct from other known membrane protein biogenesis factors such as SecYEG, SecDF-YajC, and the signal recognition particle (SRP). Further research into the unique contributions of YidD could enhance our understanding of the complex process of membrane protein insertion and folding.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific requirements. Please include any format preferences in your order remarks, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For accurate delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
yidH; b3676; JW3652; Inner membrane protein YidH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yidH
Target Protein Sequence
MKISRLGEAPDYRFSLANERTFLAWIRTALGFLAAGVGLDQLAPDFATPVIRELLALLLC LFSGGLAMYGYLRWLRNEKAMRLKEDLPYTNSLLIISLILMVVAVIVMGLVLYAG
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is YidC related to other membrane-associated proteins in E. coli?

YidC operates within a network of membrane-associated proteins. It has been identified as part of the Sec-YidC translocon and associates with SecYEG, the heterotrimeric channel complex, along with accessory components SecDF-YajC . Recent research has also revealed that YidC physically interacts with YibN, with significant functional implications for membrane protein insertion efficiency . Additionally, YidC has been co-purified with the membrane protease FtsH and its modulator proteins HflK/HflC, suggesting an early role in membrane protein quality control .

What genomic context surrounds YidC in E. coli?

The YidC gene is situated within a highly conserved gene cluster in Gram-negative bacteria. The gene order is rpmH, rnpA, yidD, yidC, and trmE . This conserved genetic organization suggests coordinated gene expression and related functions among these genes. Three promoters have been identified upstream of rpmH, one of which produces a polycistronic mRNA . The yidD gene is particularly noteworthy as it overlaps with rnpA by 37 bp and is located just 2 bp upstream of yidC, likely containing an internal promoter for yidC expression .

What are the optimal methods for producing recombinant membrane proteins in E. coli?

Two high-cell-density bacterial expression methods have proven particularly effective for membrane protein production:

  • Autoinduction method: Introduced by Studier, this approach eliminates the need for monitoring cell growth and manual induction .

  • High-cell-density IPTG-induction method: This technique achieves cell densities (OD₆₀₀) of 10-20 in normal laboratory settings using a regular incubator shaker without requiring fermentation equipment .

Using these methods, researchers can routinely obtain 14-25 mg of NMR triple-labeled proteins and 17-34 mg of unlabeled proteins from a 50-mL cell culture . These approaches are particularly valuable because they enable consistent high yields of recombinant proteins using standard E. coli expression systems.

How can researchers effectively study membrane protein insertion mechanisms in E. coli?

Several methodological approaches have proven effective:

  • Proximity-dependent biotin labeling (BioID): This technique has successfully identified interacting partners of membrane proteins, as demonstrated in the discovery of YibN as a crucial component within the YidC protein environment .

  • Affinity purification-mass spectrometry: This approach can verify protein associations in native membranes, providing evidence of interactions without artificial overexpression artifacts .

  • In vitro cross-linking: Particularly sulfhydryl cross-linking approaches can identify proteins in close proximity to nascent inner membrane proteins during their localization in the translocon. This technique revealed that YidD is positioned near nascent membrane proteins during insertion .

  • Gene knockout studies: The construction of deletion strains (e.g., ΔyidD) using approaches like the Datsenko and Wanner method allows for functional analysis of specific proteins in membrane insertion pathways .

What experimental design considerations are critical when studying membrane protein interactions?

When designing experiments to study membrane protein interactions, researchers should:

  • Clearly define variables: Identify independent variables (e.g., protein expression levels, membrane composition) and dependent variables (e.g., insertion efficiency, protein stability) .

  • Control for extraneous factors: Membrane protein research is particularly susceptible to artifacts from expression conditions. Researchers must control for factors like expression level, cell density, and membrane integrity .

  • Use multiple complementary approaches: Combine in vivo and in vitro methods to validate interactions. For example, both affinity purification and on-gel binding assays with purified proteins were used to confirm YidC-YibN interactions .

  • Consider membrane separation techniques: Methods like sucrose gradient centrifugation can be employed to isolate and study inner membrane vesicles (IMVs), allowing for more controlled analysis of membrane protein interactions .

What is known about the functional relationship between YidD and YidC in membrane protein insertion?

YidD is a small protein expressed from a gene located just 2 bp upstream of yidC . While not essential for cell growth and viability, YidD plays a significant role in the efficiency of membrane protein insertion. Experimental evidence shows that ΔyidD cells exhibit reduced insertion and processing efficiency for YidC-dependent inner membrane proteins .

In vitro cross-linking studies have positioned YidD in close proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon, suggesting a direct role in the insertion process . YidD associates with the inner membrane through a putative amphipathic α-helix in its N-terminal region, providing a structural basis for its membrane association .

The precise molecular mechanism by which YidD enhances YidC-mediated insertion remains to be fully elucidated, but current evidence suggests it may function as an accessory factor that optimizes YidC activity rather than serving as an essential component of the insertion machinery.

How does YibN interact with YidC and what are the functional implications?

YibN has been identified as a critical interactor of YidC through multiple experimental approaches including proximity-dependent biotin labeling (BioID), affinity purification-mass spectrometry, and on-gel binding assays with purified proteins . This interaction appears to have significant functional consequences:

  • YibN enhances the production and membrane insertion of YidC substrates, including M13 and Pf3 phage coat proteins, ATP synthase subunit c, and various small membrane proteins like SecG .

  • Overproduction of YibN stimulates membrane lipid production and promotes inner membrane proliferation, possibly by interfering with YidC lipid scramblase activity .

These findings position YibN as a significant modulator of YidC activity, influencing both the protein insertion and lipid organization functions of YidC. The YibN-YidC interaction represents a previously unrecognized regulatory layer in bacterial membrane biogenesis.

What is the current understanding of the YidC insertase mechanism for membrane proteins?

The YidC insertase exhibits remarkable versatility in facilitating membrane protein insertion through multiple pathways:

The molecular basis for this pathway selection remains incompletely understood, but likely involves features of the substrate proteins including transmembrane domain length, hydrophobicity, and topology.

How can researchers effectively assess membrane protein insertion efficiency?

Several complementary approaches can be employed to evaluate insertion efficiency:

  • In vivo assays: Monitoring protein levels in wild-type versus deletion strains (e.g., ΔyidD) can provide insights into insertion efficiency. Decreased steady-state levels may indicate compromised insertion .

  • Protease protection assays: These assess the correct topology of inserted membrane proteins by determining which domains are protected from externally added proteases.

  • Membrane fractionation: Techniques like sucrose gradient centrifugation can separate membrane fractions and allow quantification of properly inserted proteins versus aggregated material .

  • Reporter fusion approaches: Fusing proteins of interest to reporters like GFP can help visualize and quantify membrane localization, as demonstrated with constructs like pEH3GFP-YidD .

For rigorous assessment, researchers should employ multiple complementary techniques rather than relying on a single approach.

What genetic tools are available for studying E. coli membrane protein biogenesis?

Several genetic tools have proven valuable:

  • Gene knockout strategies: Methods like the Datsenko and Wanner approach allow precise inactivation of genes through homologous recombination. This was used to create the ΔyidD strain by replacing the gene with a kanamycin resistance cassette .

  • Expression vectors: Plasmids like pEH3 can be used for controlled expression of proteins of interest. Variants such as pEH3His-YidD incorporate affinity tags for purification, while pEH3GFP-YidD creates fusion proteins for localization studies .

  • Red-mediated recombination system: This system facilitates efficient genomic manipulation in E. coli, allowing for precise genetic modifications .

  • Controlled expression systems: Both IPTG-inducible and autoinduction systems provide options for controlled protein expression, with the latter offering advantages for achieving high cell densities without monitoring growth .

What are the critical parameters for optimizing high-yield production of recombinant membrane proteins in E. coli?

Optimization of recombinant membrane protein production requires careful attention to several parameters:

  • Expression strain selection: Different E. coli strains have varying capacities for membrane protein overexpression. Common strains include MC4100 derivatives and C41/C43 strains specifically evolved for membrane protein expression .

  • Vector design: Plasmid copy number, promoter strength, and incorporation of appropriate tags can significantly impact expression levels .

  • Media optimization: High-cell-density methods can achieve OD₆₀₀ of 10-20 in standard laboratory settings, dramatically increasing protein yield. Specialized media formulations support this high-density growth .

  • Induction strategy: The choice between IPTG induction and autoinduction affects both yield and experimental workflow. Autoinduction eliminates the need for monitoring growth and manual induction .

  • Post-translational modifications: For membrane proteins requiring specific modifications, co-expression of modification enzymes may be necessary.

Through careful optimization of these parameters, researchers can routinely obtain 14-25 mg of NMR triple-labeled proteins and 17-34 mg of unlabeled proteins from a 50-mL cell culture .

What are the major unresolved questions regarding E. coli membrane protein insertion?

Despite significant advances in understanding E. coli membrane protein insertion, several important questions remain:

  • Molecular mechanism of YidC: While structural and biochemical data on YidC are abundant, the precise mechanism by which it facilitates membrane protein insertion remains incompletely understood .

  • Regulatory networks: The functional significance of the gene clustering of rpmH, rnpA, yidD, yidC, and trmE suggests coordinated expression and function, but the regulatory mechanisms controlling this coordination require further investigation .

  • Substrate specificity determinants: The features that determine whether a protein follows the Sec-dependent, hybrid, or YidC-only pathway are not fully elucidated.

  • Interactome expansion: Recent identification of YibN as a YidC interactor suggests that additional components of the membrane protein insertion machinery may remain to be discovered .

Future research addressing these questions will further enhance our understanding of bacterial membrane protein biogenesis and potentially reveal new targets for antimicrobial development.

How might advances in E. coli membrane protein research translate to other bacterial systems?

  • Conservation analysis: Detailed sequence and structural analysis of homologs across species can identify conserved functional elements versus species-specific adaptations.

  • Complementation studies: Testing whether proteins from other species can functionally replace E. coli components provides insights into functional conservation.

  • Comparative genomics: The conserved gene cluster containing yidC in Gram-negative bacteria suggests coordinated function, but organization may differ in other bacterial phyla .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.