Recombinant Escherichia coli Inner membrane protein yidI (yidI)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Escherichia coli Inner Membrane Protein YidI (YidI)

YidI is an inner membrane protein in Escherichia coli that plays a crucial role in the biogenesis of other membrane proteins . It is related to Oxa1p in mitochondria and Alb3 in chloroplasts, all of which are involved in the insertion and folding of newly synthesized proteins into the membrane .

Genetic Context and Expression of YidI

The yidI gene is part of a highly conserved gene cluster in Gram-negative bacteria, which includes rpmH, rnpA, yidD, yidC, and trmE . The yidD gene overlaps with rnpA and is located just upstream of yidC, potentially containing an internal promoter for yidC . Studies have confirmed that yidD is expressed in E. coli and associates with the inner membrane via an amphipathic α-helix in its N-terminal region .

Role of YidI in Membrane Protein Insertion

YidI functions as a membrane insertase, facilitating the integration of newly synthesized membrane proteins into the lipid bilayer . It is involved in the insertion of proteins that do not require the Sec machinery and can work independently of the Sec translocase for certain proteins . For Sec-dependent proteins, YidI works in conjunction with the Sec translocase to transfer transmembrane regions into the hydrophobic bilayer .

Functional Relationship with YidC and Other Proteins

YidI interacts with YidC and SecYEGDF . YidC, a close homolog of YidI, is essential for the insertion and maturation of inner membrane proteins (IMPs) . YidI is required for efficient insertion and maturation of YidC-dependent IMPs .

Experimental Evidence and Research Findings

ExperimentFindings
In vitro cross-linkingShowed that YidD is in proximity to a nascent inner membrane protein during its localization in the Sec-YidC translocon, suggesting its involvement in the insertion process .
Reconstitution of YidC into liposomesDemonstrated that YidC could efficiently support the membrane insertion of the purified Pf3 coat protein .
Artificial recruitment of Yap1802 and Syp1 toRedirects Ede1 to the mother cell, indicating that early-arriving proteins act in different combinations in response to various cargos at different local environments .
eisosomes

YidI's Role in Quality Control

YidI has been copurified with the membrane protease FtsH and its modulator proteins HflK/HflC, suggesting a role in the quality control of membrane proteins .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
yidI; b3677; JW3653; Inner membrane protein YidI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yidI
Target Protein Sequence
MGIIAQNKISSLGMLFGAIALMMGIIHFSFGPFSAPPPTFESIVADKTAEIKRGLLAGIK GEKITTVEKKEDVDVDKILNQSGIALAIAALLCAFIGGMRKENRWGIRGALVFGGGTLAF HTLLFGIGIVCSILLIFLIFSFLTGGSLV
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidD and what is its role in E. coli membrane biology?

YidD is a small protein that localizes to the inner membrane of Escherichia coli, likely through an amphipathic helix in its N-terminal region. The yidD gene is part of a highly conserved gene cluster in Gram-negative bacteria, with the gene order being rpmH, rnpA, yidD, yidC, and trmE. Functionally, YidD appears to play a role in the insertion and processing of YidC-dependent inner membrane proteins (IMPs) .

Research indicates that while YidD is not essential for cell growth and viability, its deletion affects the insertion and processing efficiency of several YidC-dependent inner membrane proteins. Cross-linking experiments have shown that YidD is in proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon, suggesting a direct involvement in the membrane protein insertion process .

How is YidD genetically organized and expressed?

The yidD gene is sandwiched between rnpA (with a 37-bp overlap) and yidC (with only a 2-bp spacing). This genetic organization is significant because:

  • The close proximity suggests functional relationships between these genes

  • The yidD gene likely contains an internal promoter for yidC

  • The gene cluster is highly conserved across Gram-negative bacteria, indicating evolutionary importance

Expression studies have verified that yidD is indeed expressed in E. coli, despite its overlapping genetic organization. Researchers have successfully amplified yidD using E. coli MC4100 genomic DNA as a template and cloned it into expression vectors such as pEH3, enabling the production of recombinant YidD protein for further studies .

What experimental approaches can verify YidD membrane localization?

Several complementary experimental approaches can be used to confirm YidD's membrane localization:

  • Subcellular fractionation: Isolation of inner membrane vesicles (IMVs) followed by detection of YidD in the membrane fraction using immunoblotting.

  • Fluorescent protein fusion: Construction of GFP-YidD fusion proteins (as described in the research where pEH3GFP-YidD was created) to visualize cellular localization using fluorescence microscopy .

  • Membrane extraction assays: Treatment of membrane fractions with different detergents or chaotropic agents to determine the strength of membrane association.

  • Protease protection assays: Determining topology by assessing which regions are protected from protease digestion when membranes are intact.

  • Amphipathic helix analysis: Computational prediction and experimental mutation of the N-terminal amphipathic helix to verify its role in membrane association.

Experimental ApproachAdvantagesLimitationsKey Controls
Subcellular fractionationBiochemical verificationPotential cross-contaminationPure cytoplasmic and membrane markers
GFP fusion visualizationDirect in vivo observationPotential tag interferenceFree GFP control
Membrane extractionTests strength of associationDetergent variabilityKnown integral and peripheral proteins
Protease protectionReveals topologyIncomplete digestionDetergent permeabilization controls
Helix mutationsTests specific mechanismPotential pleiotropic effectsConservative vs. disruptive mutations

What is the molecular mechanism by which YidD facilitates membrane protein insertion?

While the precise molecular mechanism remains to be fully elucidated, in vitro cross-linking experiments have shown that YidD is in proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon. This suggests a direct interaction with the insertion machinery and possibly with substrate proteins themselves .

The current evidence points toward YidD functioning as a facilitator or accessory factor in the insertion process rather than being absolutely essential. Possible mechanistic roles include:

  • Acting as a chaperone to prevent aggregation of membrane protein intermediates

  • Facilitating the handoff of nascent membrane proteins between the Sec translocon and YidC

  • Stabilizing specific conformations of YidC to optimize insertion of certain substrates

  • Contributing to the proper assembly of multi-protein insertion complexes

To further elucidate this mechanism, researchers could employ:

  • Site-specific crosslinking using introduced cysteines or unnatural amino acids

  • Cryo-electron microscopy of ribosome-nascent chain-translocon complexes with and without YidD

  • Systematic mutagenesis to identify functional residues in YidD

  • In vitro reconstitution of the insertion process with purified components

How does YidD function relate to different membrane protein insertion pathways in E. coli?

E. coli employs multiple pathways for membrane protein insertion, including the Sec-dependent, YidC-only, and Sec-YidC cooperative pathways. Research suggests that YidD's role may vary depending on the specific pathway and substrate proteins .

For YidC-only substrates (such as F₁Fo ATPase subunits a and c, NADH dehydrogenase subunit K, and phage coat proteins), YidD deletion appears to have measurable effects on insertion efficiency. These proteins are typically small and relatively simple in topology .

The relationship between YidD and different insertion pathways can be summarized as:

Insertion PathwayRepresentative SubstratesYidD InvolvementKey Characteristics
YidC-onlyF₁Fo ATPase subunits a/c, NADH dehydrogenase subunit KSignificant effect when deletedSmall proteins, simple topology
Sec-YidC cooperativeCyoA (cytochrome bo₃ oxidase)Potentially involved but not characterizedComplex proteins with domains requiring both systems
Sec-dependent with YidC interactionLep, FtsQ, MtlAMinimal effect when YidD deletedProteins that laterally exit Sec translocon
Sec-dependentVarious secretory and membrane proteinsLikely no significant roleProteins not requiring YidC

Research strategies to further clarify these relationships could include:

  • Systematic analysis of insertion efficiency for various substrates in ΔyidD strains

  • Biochemical characterization of YidD interactions with components of each pathway

  • Suppressor screening to identify genetic interactions between yidD and other pathway components

What experimental design would best elucidate YidD's interaction with the Sec-YidC insertion machinery?

A comprehensive experimental approach would combine multiple complementary techniques:

  • In vivo crosslinking studies:

    • Express photo-activatable or chemical crosslinkers incorporated into YidD

    • Identify interaction partners by mass spectrometry after crosslinking

    • Map interaction interfaces by analyzing crosslinked residues

  • Co-purification experiments:

    • Perform pull-down assays with tagged YidD to identify stable interactors

    • Use varying detergent and salt conditions to distinguish strong vs. weak interactions

    • Confirm interactions by reciprocal pull-downs with Sec and YidC components

  • Genetic interaction mapping:

    • Create double mutants combining ΔyidD with mutations in sec and yidC genes

    • Look for synthetic phenotypes indicating functional relationships

    • Perform high-throughput genetic screens to identify suppressors

  • Structural biology approaches:

    • Use cryo-EM to visualize YidD in complex with the insertion machinery

    • Perform hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Model interactions computationally and validate predictions experimentally

  • Reconstitution in proteoliposomes:

    • Purify individual components and reconstitute minimal insertion systems

    • Compare insertion efficiency with and without YidD

    • Test substrate specificity using various model membrane proteins

How should researchers approach the expression and purification of recombinant YidD?

Successful expression and purification of membrane proteins like YidD require careful optimization:

  • Strain selection:

    • Use specialized expression strains like BL21ΔABCF that have deletions of major outer membrane proteins, reducing competition for insertion machinery

    • Consider C41/C43 strains specifically engineered for membrane protein expression

  • Expression construct design:

    • Include affinity tags (His6, StrepII) for purification, placed at positions least likely to interfere with function

    • Consider fusion partners (MBP, SUMO) to improve solubility

    • Include protease cleavage sites for tag removal

    • Use low-copy vectors with tunable promoters

  • Optimization of expression conditions:

    • Test different induction temperatures (typically 18-30°C for membrane proteins)

    • Vary inducer concentration to control expression level

    • Consider longer expression times at lower temperatures

    • Test different media compositions and additives

  • Membrane extraction and solubilization:

    • Screen multiple detergents (DDM, LMNG, LDAO) for optimal solubilization

    • Test detergent:protein ratios carefully

    • Consider native nanodiscs or styrene-maleic acid copolymer (SMA) extraction for detergent-free purification

  • Purification strategy:

    • Use multi-step purification (affinity, ion exchange, size exclusion)

    • Include stabilizing additives (glycerol, specific lipids)

    • Monitor protein quality by size exclusion chromatography

    • Verify function after purification

For structural studies, expression levels can be further optimized:

Optimization StrategyImplementationExpected Benefit
Strain engineeringDelete competing membrane proteinsImproved insertion efficiency
Codon optimizationAdapt codons to E. coli preferenceEnhanced translation
Media supplementationAdd specific phospholipidsStabilize membrane proteins
Expression timingSlow, controlled inductionProper membrane insertion
Temperature reductionExpress at 18-25°CImproved folding kinetics

How can researchers assess the functional significance of YidD's amphipathic helix?

The N-terminal amphipathic helix in YidD likely plays a crucial role in membrane association. To investigate its significance:

  • Helix property analysis:

    • Use computational tools to analyze amphipathicity, hydrophobic moment, and charge distribution

    • Compare with known amphipathic helices from other membrane-associated proteins

    • Model the helix-membrane interaction using molecular dynamics simulations

  • Mutagenesis approaches:

    • Create point mutations that alter key properties (hydrophobicity, charge)

    • Design truncations to remove the helix entirely

    • Generate chimeric constructs replacing the helix with amphipathic sequences from other proteins

  • Membrane association assays:

    • Compare wild-type and mutant YidD localization using fractionation

    • Use fluorescence microscopy with GFP fusions to visualize localization changes

    • Measure membrane binding using liposome flotation assays with purified proteins

  • Functional complementation:

    • Test the ability of helix mutants to restore wild-type phenotypes in ΔyidD strains

    • Measure membrane protein insertion efficiency with different helix variants

    • Correlate membrane association strength with functional restoration

  • Structural studies:

    • Use NMR to determine the structure of the helix in membrane-mimetic environments

    • Perform EPR studies to measure membrane penetration depth

    • Use crosslinking to determine orientation relative to the membrane

What controls are essential when studying YidD-dependent membrane protein insertion?

Robust experimental design for studying YidD requires careful consideration of controls:

  • Genetic controls:

    • Wild-type strain (positive control)

    • ΔyidD strain (experimental condition)

    • ΔyidD complemented with plasmid-encoded YidD (restoration control)

    • ΔyidC strain (comparison with known essential insertase)

  • Protein substrate controls:

    • YidC-dependent substrates (expected to show effects)

    • Sec-dependent substrates (not expected to show major effects)

    • Cytoplasmic proteins (negative control for specificity)

  • Expression level controls:

    • Monitor YidD expression levels using western blotting

    • Ensure comparable expression between wild-type and complemented strains

    • Use inducible promoters to test different expression levels

  • Membrane integrity controls:

    • Measure membrane potential to ensure viability

    • Monitor growth rates to detect general physiological effects

    • Assess general membrane protein profiles by SDS-PAGE

  • Technical controls:

    • Multiple biological replicates

    • Different detection methods for membrane insertion

    • Independent validation using multiple approaches

How can researchers quantitatively assess YidD's impact on membrane protein insertion efficiency?

Several quantitative approaches can measure insertion efficiency:

  • Pulse-chase analysis:

    • Label newly synthesized proteins with radioactive amino acids

    • Chase with unlabeled amino acids

    • Measure appearance of properly inserted membrane proteins over time

    • Compare kinetics between wild-type and ΔyidD strains

  • Reporter protein systems:

    • Fuse model substrates with easily measurable reporters (GFP, luciferase)

    • Quantify successful insertion by measuring reporter activity

    • Design split reporter systems that only function upon proper membrane insertion

  • Proteomics approaches:

    • Use stable isotope labeling (SILAC) to compare membrane proteomes

    • Perform quantitative mass spectrometry on membrane fractions

    • Calculate relative abundances of various membrane proteins

  • In vitro translation-insertion systems:

    • Use purified components to reconstitute the insertion process

    • Measure insertion efficiency into liposomes or nanodiscs

    • Compare systems with and without YidD

  • Biochemical fractionation:

    • Separate properly inserted proteins from aggregates or mislocalized forms

    • Quantify distribution between fractions

    • Calculate insertion efficiency ratios

A sample experimental design table for quantitative assessment:

ParameterDescriptionMeasurement Method
Independent VariableYidD presence/absenceWild-type vs. ΔyidD strains
Dependent VariableMembrane protein insertion efficiencyQuantitative proteomics, reporter assays
Control GroupWild-type E. coli with normal YidD expressionStandardized culture conditions
Controlled VariablesTemperature, media composition, growth phase, expression levels of substrate proteinsRigorous standardization protocols
Number of replicatesMinimum 3 biological replicates with 3 technical replicates eachStatistical analysis with appropriate tests

How should researchers resolve contradictory findings about YidD function?

When faced with contradictory results regarding YidD function, researchers should:

  • Examine methodological differences:

    • Compare in vivo vs. in vitro approaches

    • Assess differences in strain backgrounds

    • Evaluate expression levels and conditions

    • Consider differences in substrate proteins tested

  • Investigate context-dependent functions:

    • Test function under different growth conditions

    • Examine effects at different growth phases

    • Consider environmental stressors that might reveal phenotypes

  • Analyze genetic backgrounds thoroughly:

    • Screen for suppressor mutations

    • Check for unintended polar effects on yidC expression

    • Consider compensatory mechanisms that might mask phenotypes

  • Perform quantitative rather than qualitative assessments:

    • Use sensitive assays that can detect subtle changes

    • Perform time-course experiments to capture kinetic differences

    • Use statistical approaches appropriate for small effect sizes

  • Conduct epistasis analysis:

    • Create double mutants with other components of insertion machinery

    • Look for synthetic phenotypes that reveal conditional importance

    • Test for genetic interactions that might explain variable results

A decision tree for resolving contradictions could include:

  • Verify strain construction and genotypes

  • Confirm YidD expression/absence by multiple methods

  • Test under multiple growth conditions

  • Examine effects on multiple substrate proteins

  • Use complementation to confirm phenotype causality

  • Measure quantitative rather than qualitative effects

  • Consider kinetic versus equilibrium measurements

What bioinformatic approaches can guide YidD research and experimental design?

Bioinformatic analysis provides valuable insights to guide experimental work:

  • Sequence conservation analysis:

    • Identify highly conserved residues across bacterial species

    • Map conservation onto predicted structural features

    • Prioritize these residues for mutational analysis

  • Structural prediction:

    • Use protein structure prediction algorithms (AlphaFold, RoseTTAFold)

    • Model membrane interaction surfaces

    • Predict potential interaction interfaces with other proteins

  • Genomic context analysis:

    • Compare gene neighborhoods across bacterial species

    • Identify co-evolved genes that might share functions

    • Look for regulatory patterns in the gene cluster

  • Protein-protein interaction prediction:

    • Use coevolution-based methods to predict interaction partners

    • Identify potential binding sites based on surface properties

    • Model complexes with known insertion machinery components

  • Expression pattern analysis:

    • Analyze transcriptomics data across conditions

    • Identify conditions where yidD is differentially regulated

    • Look for co-regulated genes that might share functions

These approaches help prioritize experimental efforts by focusing on:

  • Most conserved protein features

  • Likely interaction partners

  • Conditions where YidD function might be most relevant

  • Potential substrate proteins based on co-expression patterns

What emerging technologies could advance understanding of YidD function?

Several cutting-edge technologies could significantly advance YidD research:

  • Cryo-electron tomography:

    • Visualize membrane protein insertion in situ

    • Observe native arrangements of insertion machinery

    • Compare wild-type and ΔyidD cells for structural differences

  • Single-molecule approaches:

    • Track individual insertion events in real-time

    • Measure kinetics at unprecedented resolution

    • Detect transient intermediates in the insertion process

  • Genome-wide CRISPRi screens:

    • Systematically identify genetic interactions with yidD

    • Discover conditional essentiality patterns

    • Map the broader network of membrane protein biogenesis

  • Time-resolved structural methods:

    • Capture insertion intermediates at defined timepoints

    • Visualize conformational changes during insertion

    • Determine the structural basis of YidD function

  • Proximity labeling proteomics:

    • Use BioID or APEX2 fusions to identify proximal proteins in vivo

    • Map the dynamic interactome of YidD

    • Discover previously unknown interaction partners

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Develop systems-level models of membrane protein biogenesis

    • Identify emergent properties not visible in isolated experiments

How can structural biology approaches be optimized for studying YidD?

Structural biology of membrane proteins like YidD presents unique challenges requiring specialized approaches:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.