Recombinant Escherichia coli Inner membrane protein yijD (yijD)

Shipped with Ice Packs
In Stock

Description

Recombinant Production in E. coli

YijD is produced recombinantly in E. coli with a His-tag for purification. Key parameters include:

ParameterDetails
Expression systemE. coli BL21(DE3) or similar strains optimized for membrane proteins
VectorPlasmid with T7/lac promoter system
PurificationImmobilized metal affinity chromatography (IMAC) via N-terminal His-tag
Purity>90% (verified by SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0)

Challenges in recombinant production align with broader issues in membrane protein expression, such as insolubility and improper folding . Co-expression with chaperones (e.g., GroEL/GroES) or use of strains like C41(DE3) may improve yields .

Research Applications

YijD is primarily used to study:

  1. Membrane protein biogenesis: As a model for Sec/YidC-dependent insertion pathways .

  2. Stationary-phase adaptations: Interactions with ribosomes under nutrient-limiting conditions .

  3. Stress response networks: Links to RpoS-regulated pathways .

Future Directions

Key unanswered questions include:

  • Mechanistic role: Does YijD stabilize ribosome-membrane interactions or modulate translation during stress?

  • Structural analysis: High-resolution structures to map ribosome-binding domains.

  • Interactome profiling: Identification of binding partners via cross-linking or pull-down assays.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
yijD; b3964; JW3936; Inner membrane protein YijD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yijD
Target Protein Sequence
MKQANQDRGTLLLALVAGLSINGTFAALFSSIVPFSVFPIISLVLTVYCLHQRYLNRTMP VGLPGLAAACFILGVLLYSTVVRAEYPDIGSNFFPAVLSVIMVFWIGAKMRNRKQEVAE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yijD and how does it differ from YidD in E. coli?

While limited information is available specifically about yijD in the current literature, it is important to distinguish it from YidD. YidD is a well-characterized inner membrane protein in E. coli that functions in membrane protein insertion and folding processes. YidD is located in a conserved gene cluster (rpmH, rnpA, yidD, yidC, and trmE) in Gram-negative bacteria . It associates with the inner membrane via an amphipathic helix in its N-terminal region . Unlike YidD, specific functional details about yijD remain less documented in published research.

What is currently known about the localization and expression of inner membrane proteins in E. coli?

Inner membrane proteins in E. coli are localized to the cytoplasmic membrane, which separates the cytoplasm from the periplasmic space. For proteins like YidD, localization can be confirmed through membrane fractionation techniques such as isopycnic sucrose gradient centrifugation . Expression of inner membrane proteins can be verified using techniques like SDS-PAGE and Western blotting. For YidD specifically, studies have verified its expression in E. coli and confirmed its association with the inner membrane .

What roles do inner membrane proteins like yijD play in bacterial cell physiology?

Inner membrane proteins in E. coli serve diverse functions including transport, signaling, energy production, and protein insertion. While yijD's specific function is not extensively documented in the provided research, comparable proteins like YidD play roles in membrane protein biogenesis. YidD has been shown to affect the insertion and processing of YidC-dependent inner membrane proteins, though its inactivation does not significantly impact cell growth and viability .

How do inner membrane proteins interact with the Sec-YidC translocon during membrane insertion?

Membrane proteins can interact with the Sec-YidC translocon during their insertion into the E. coli inner membrane. The Sec translocon consists of the heterotrimeric channel complex SecYEG and accessory components SecDF-YajC . YidC has been identified as another Sec-associated factor through cross-linking and pulldown experiments . For a subset of inner membrane proteins such as Lep, FtsQ, and MtlA, YidC associates with transmembrane segments of nascent protein chains as they exit laterally from the Sec translocon . YidD has been shown through in vitro cross-linking to be in proximity to nascent inner membrane proteins during their localization in the Sec-YidC translocon, suggesting its involvement in the insertion process .

What methodologies are most effective for studying protein-protein interactions involving inner membrane proteins?

Several methodologies can be employed to study interactions involving inner membrane proteins:

MethodologyApplicationAdvantagesLimitations
In vitro cross-linkingDetecting proximity between proteinsCan capture transient interactionsMay yield false positives
Co-immunoprecipitationIsolating protein complexesWorks with native proteinsRequires specific antibodies
Bacterial two-hybridScreening potential interactionsHigh-throughput capabilityMay not work well for membrane proteins
FRET/BRETReal-time interaction monitoringCan provide spatial informationRequires protein labeling
Blue native PAGEPreserving native complexesMaintains functional interactionsLimited resolution

For YidD specifically, sulfhydryl cross-linking approaches have been used to demonstrate its proximity to nascent inner membrane proteins .

How do genomic context and gene conservation patterns inform the study of inner membrane proteins?

The genomic context of membrane protein genes can provide valuable insights into their potential functions. For example, YidD is located in a gene cluster that is highly conserved among Gram-negative bacteria, with the gene order being rpmH, rnpA, yidD, yidC, and trmE . This conserved organization suggests coordinated gene expression and related functions. YidD homologs, defined by the presence of the conserved domain of unknown function 37 (DUF37), are widely spread in Gram-positive bacteria (though with less conserved genomic context) and are found in all plants sequenced so far, but not in yeast, C. elegans, or mammals . This evolutionary conservation pattern suggests fundamental importance in certain biological processes.

What expression systems are optimal for recombinant inner membrane protein production?

For recombinant inner membrane protein production, several expression systems can be considered:

Expression SystemAdvantagesConsiderations
E. coli strains (C41, C43, BL21)High yield, ease of useMay require optimization of induction conditions
Cell-free systemsAvoids cytotoxicity issuesHigher cost, specialized equipment
Yeast expression systemsPost-translational modificationsDifferent membrane composition
Insect/mammalian cellsMore native-like environmentLower yields, higher complexity

For E. coli inner membrane proteins, homologous expression in specialized E. coli strains is often preferable. In published research, strains like MC4100-A have been used for expression and preparation of inner membrane vesicles (IMVs) and translation extracts .

What strategies can overcome challenges in membrane protein purification while maintaining native structure?

Purification of membrane proteins presents unique challenges due to their hydrophobic nature. Strategies to address these include:

  • Careful selection of detergents for solubilization (DDM, LMNG, or digitonin often preserve function)

  • Use of amphipols or nanodiscs to maintain a membrane-like environment

  • Optimization of buffer conditions (pH, ionic strength, stabilizing additives)

  • Incorporating fusion tags that enhance stability and solubility

  • Employing mild purification conditions to preserve native structure

For YidD specifically, researchers have used isopycnic sucrose gradient centrifugation to isolate inner membrane vesicles, which were then used for further experiments .

How can genetic modification techniques be applied to study inner membrane protein function?

Various genetic approaches can be employed to study inner membrane protein function:

  • Gene knockout/knockdown: The ΔyidD strain was constructed according to the Datsenko and Wanner method, using kanamycin cassette amplification from pKD13 followed by red-mediated recombination .

  • Site-directed mutagenesis: Can be performed using methods like the QuikChange Site-Directed Mutagenesis Kit to introduce specific mutations .

  • Transcriptional fusions: For YidD, researchers created lacZ transcriptional fusions to study promoter activity .

  • Protein tagging approaches: His-tagged and GFP-fusion constructs have been used to study YidD, facilitating detection and localization studies .

What analytical methods provide the most reliable structural information for inner membrane proteins?

Several analytical methods can provide structural information about inner membrane proteins:

MethodInformation ProvidedTechnical Requirements
X-ray crystallographyHigh-resolution static structureRequires well-diffracting crystals
Cryo-electron microscopyMedium to high resolution structureNeeds homogeneous samples
NMR spectroscopyDynamic information, ligand interactionsLimited by protein size
Molecular dynamics simulationsDynamic behavior predictionsRequires initial structural models
Circular dichroismSecondary structure contentLower resolution, good for verification
Cross-linking mass spectrometryProximity mapping, topologyRequires careful cross-linker selection

For membrane proteins like YidD, researchers have used membrane separation by sucrose gradient centrifugation followed by analysis by SDS-PAGE and Western blotting to study localization .

How can researchers distinguish between direct and indirect effects when studying inner membrane protein function?

Distinguishing between direct and indirect effects requires rigorous experimental design:

  • Complementation studies: Reintroducing the wild-type gene to rescue phenotypes observed in knockout strains.

  • Domain-specific mutations: Creating targeted mutations that affect specific functions rather than wholesale gene deletion.

  • Timing analysis: Examining the temporal sequence of events following perturbation.

  • In vitro reconstitution: Testing purified components to verify direct interactions.

  • Control experiments: Including appropriate controls for each experimental condition.

For YidD, researchers observed that ΔyidD cells were affected in the insertion and processing of three YidC-dependent inner membrane proteins compared to control cells, suggesting a functional relationship .

What in vitro systems can model the membrane environment for functional studies?

Several in vitro systems can effectively model membrane environments:

SystemApplicationsAdvantages
LiposomesReconstitution of transport processesSimple preparation, controllable composition
NanodiscsSingle-protein studies, structural analysisDefined size, accessibility from both sides
ProteoliposomesFunctional assays, transport studiesMimics native environment, suitable for assays
BicellesNMR studies, small membrane proteinsGood for structural studies
Inner membrane vesicles (IMVs)Multi-protein complexes, native-like studiesPreserves native protein complexes

For studies involving YidD, researchers have isolated inner membrane vesicles (IMVs) from E. coli cells expressing His-tagged YidD for further experiments .

How might systems biology approaches enhance our understanding of inner membrane protein networks?

Systems biology approaches could significantly advance our understanding of membrane protein networks by:

  • Integrating multi-omics data (proteomics, transcriptomics, metabolomics) to identify co-regulated genes and proteins

  • Network analysis to predict functional relationships and identify protein complexes

  • Flux balance analysis to understand the impact of membrane proteins on cellular metabolism

  • Comparative genomics to identify conserved protein complexes across bacterial species

  • Computational modeling of membrane protein dynamics within the context of cellular networks

The conserved gene cluster containing YidD (rpmH, rnpA, yidD, yidC, and trmE) suggests coordinated expression and related functions that could be further explored through systems approaches .

What emerging technologies might address current limitations in membrane protein research?

Several emerging technologies show promise for advancing membrane protein research:

  • Cryo-electron tomography for visualizing membrane proteins in their native cellular context

  • Single-molecule techniques to study dynamics and conformational changes

  • Advanced mass spectrometry methods for studying membrane protein complexes

  • Microfluidic platforms for high-throughput screening of membrane protein expression and function

  • AI-based structural prediction tools specifically optimized for membrane proteins

These technologies could help overcome current limitations in studying proteins like yijD and expand our understanding of their structures, functions, and interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.