Recombinant Escherichia coli Inner membrane protein yjcH (yjcH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
yjcH; b4068; JW4029; Inner membrane protein YjcH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yjcH
Target Protein Sequence
MNGTIYQRIEDNAHFRELVEKRQRFATILSIIMLAVYIGFILLIAFAPGWLGTPLNPNTS VTRGIPIGVGVIVISFVLTGIYIWRANGEFDRLNNEVLHEVQAS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is yjcH protein and what is its functional significance in E. coli?

yjcH is an inner membrane protein in Escherichia coli that shares structural and potentially functional similarities with other bacterial membrane proteins involved in cell envelope biogenesis and maintenance. Although less extensively studied than related proteins like YhcB and YajC, it likely contributes to membrane integrity and potentially to biofilm formation. Similar membrane proteins such as YhcB have been demonstrated to interact with cell shape proteins including RodZ, MreCD, and RodA, suggesting a potential role in peptidoglycan synthesis and cell morphology determination .

Based on comparative analysis with similar membrane proteins, yjcH may be part of protein complexes integrated in the inner membrane that assist in peptidoglycan synthesis by directing enzymes and other molecules to the appropriate sites. The significance of studying yjcH lies in better understanding bacterial cell envelope formation and potentially identifying new antimicrobial drug targets.

What expression systems are most suitable for recombinant yjcH production?

Several expression systems can be employed for recombinant yjcH production, each with distinct advantages:

Expression SystemAdvantagesLimitationsBest For
E. coli (BL21(DE3))High yield, cost-effective, rapid growthPotential for inclusion bodies, improper foldingInitial screening, high-throughput studies
E. coli Rosetta-GAMIEnhanced disulfide bond formation, accommodates rare codonsLower yield than standard BL21Proteins requiring proper disulfide bonding
Yeast (P. pastoris)Post-translational modifications, less endotoxinLonger expression time, more complex protocolsFunctional studies requiring native folding
Insect cells (Sf9, Sf21)Superior folding for complex membrane proteinsHigher cost, technically demandingStructural studies requiring native conformation

For initial characterization studies, E. coli-based systems represent the most straightforward approach, with BL21(DE3) being particularly suitable for membrane proteins like yjcH . For functional studies requiring proper folding and insertion into membranes, yeast or insect cell systems may yield better results despite their higher complexity.

What are the critical parameters for successful expression of recombinant yjcH?

Successful expression of recombinant yjcH depends on optimizing several critical parameters:

  • Induction conditions: Lower temperatures (16-25°C) often improve folding of membrane proteins. Induction at OD600 0.6-0.8 with reduced IPTG concentrations (0.1-0.5 mM) typically yields better results than standard conditions.

  • Codon optimization: Given that membrane proteins often contain rare codons, codon optimization for the expression host is crucial. This can be particularly important when expressing yjcH in heterologous systems .

  • Fusion tags: Strategic selection of fusion tags can dramatically improve expression and solubility. For membrane proteins like yjcH, maltose-binding protein (MBP) or thioredoxin (TrxA) tags often perform better than standard His-tags alone.

  • Media composition: Supplementation with additional components such as glycerol (0.5-1%) can help stabilize membrane proteins during expression.

  • Expression time: Extended expression times (24-48 hours) at lower temperatures often yield better results for membrane proteins compared to shorter, high-temperature expressions.

How can I determine the membrane topology of yjcH?

Determining the membrane topology of yjcH requires a multi-technique approach:

  • Computational prediction: Begin with in silico analysis using algorithms specialized for membrane proteins such as TMHMM, Phobius, and TOPCONS to predict transmembrane domains and orientation.

  • Fusion reporter systems: Create fusion constructs with reporter proteins (such as GFP, alkaline phosphatase, or β-lactamase) at different positions to experimentally verify the predicted topology. Alkaline phosphatase is active only when located in the periplasm, while β-lactamase shows differential activity based on cellular location.

  • Protease accessibility assays: Using proteases that cannot cross the membrane to digest exposed protein regions, combined with western blotting using domain-specific antibodies.

  • Substituted cysteine accessibility method (SCAM): Introducing cysteine residues at various positions and analyzing their accessibility to membrane-impermeable sulfhydryl reagents.

Much like the approach used for YhcB, where research confirmed a single transmembrane domain with the C-terminus located in the cytoplasm, similar methods can be applied to elucidate yjcH topology .

What approaches can be used to study yjcH interactions with other membrane proteins?

Several complementary approaches can be employed to study yjcH protein interactions:

  • Bacterial two-hybrid system (BACTH): This system has been successfully used to demonstrate interactions between related membrane proteins such as YhcB and RodZ. For yjcH, similar constructs can be designed with T18 and T25 fragments of Bordetella pertussis adenylate cyclase fused to yjcH and potential interacting proteins .

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged versions of yjcH to pull down interaction partners, followed by mass spectrometry identification.

  • Chemical cross-linking coupled with mass spectrometry: This approach can capture transient interactions between yjcH and other membrane proteins.

  • Fluorescence resonance energy transfer (FRET): By tagging yjcH and potential interaction partners with appropriate fluorophores, in vivo interactions can be visualized in real-time.

  • Surface plasmon resonance (SPR): For quantitative analysis of binding kinetics between purified yjcH and its interaction partners.

The BACTH system is particularly valuable for membrane proteins as it allows for detection of interactions in their native membrane environment. YhcB has been shown to interact with several proteins involved in cell shape maintenance using this technique, suggesting similar approaches would be effective for yjcH .

How can I troubleshoot poor expression yields of recombinant yjcH?

Poor expression yields of membrane proteins like yjcH are common. Here are systematic troubleshooting approaches:

ProblemPotential CausesSolutions
Low expression levelToxicity to host cellsUse tightly regulated promoters (e.g., pBAD), C41/C43 E. coli strains specialized for toxic membrane proteins
Rare codonsUse codon-optimized gene synthesis or Rosetta strains containing rare tRNA genes
Protein instabilityLower expression temperature (16-20°C), add stabilizing agents (glycerol, specific detergents)
Inclusion body formationImproper foldingCo-express with molecular chaperones (GroEL/ES, DnaK/J), use fusion partners that enhance solubility (MBP, SUMO)
Excessive expression rateReduce inducer concentration, use weaker promoters
Proteolytic degradationProtease sensitivityAdd protease inhibitors, use protease-deficient strains, optimize extraction buffer composition
Inefficient membrane insertionOverloading membrane capacityReduce expression level, use specialized strains with enhanced membrane protein insertion machinery

For particularly challenging cases, switching to alternative expression systems such as yeast or insect cells may be necessary, as these often provide better membrane protein folding environments .

What are the most effective methods for purifying recombinant yjcH while maintaining its native conformation?

Purification of membrane proteins like yjcH requires careful consideration of detergents and conditions to maintain native structure:

  • Membrane preparation: After cell lysis (typically via French press or sonication), collect membranes by ultracentrifugation (100,000 × g for 1 hour).

  • Solubilization screening: Test a panel of detergents at various concentrations to identify optimal solubilization conditions:

Detergent ClassExamplesConcentration RangeBest For
Mild non-ionicDDM, LMNG, OG0.5-2%Maintaining native structure, enzymatic activity
ZwitterionicLDAO, Fos-choline0.5-1%High extraction efficiency, crystallography
Peptide-basedSMA polymers, amphipols2.5% SMA, 1:4 protein:amphipolExtracting proteins with native lipid environment
  • Affinity chromatography: Utilize fusion tags (preferably at the C-terminus if topology allows) for initial purification, with immobilized metal affinity chromatography (IMAC) being most common for His-tagged proteins.

  • Size exclusion chromatography: Critical for removing aggregates and ensuring homogeneity of the sample.

  • Lipid reconstitution: For functional studies, reconstitute purified yjcH into proteoliposomes or nanodiscs using E. coli lipid extracts or defined lipid mixtures.

Throughout purification, it's essential to monitor protein stability using techniques such as circular dichroism or fluorescence spectroscopy to confirm that the native conformation is maintained.

How can I validate that recombinant yjcH is correctly folded and functional?

Validating correct folding and functionality of recombinant yjcH requires several complementary approaches:

  • Circular dichroism (CD) spectroscopy: To assess secondary structure content and stability under different conditions.

  • Thermostability assays: Such as differential scanning fluorimetry (DSF) to evaluate protein stability in various detergents and buffer conditions.

  • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): To confirm monodispersity and determine oligomeric state.

  • Functional assays: For yjcH, functional assays could include:

    • Complementation assays in yjcH deletion strains to restore wild-type phenotypes

    • Binding assays with known interaction partners (once identified)

    • Biofilm formation assays, as membrane proteins like YajC have been implicated in biofilm development

  • Proteoliposome reconstitution: Assessing whether reconstituted yjcH can perform expected functions in artificial membrane systems.

Since the specific function of yjcH may not be fully characterized, comparing its biophysical properties with those of well-studied homologs can provide indirect evidence of proper folding.

What genetic manipulation approaches are most effective for studying yjcH function in vivo?

Several genetic approaches can be employed to study yjcH function:

  • Markerless deletion mutants: Creating clean deletions without antibiotic resistance markers allows for precise phenotypic analysis without polar effects on neighboring genes. This approach has been successfully used for membrane proteins like YajC .

  • Controllable expression systems: Using inducible promoters to modulate yjcH expression levels can help identify concentration-dependent effects and mitigate potential toxicity issues.

  • Complementation studies: Reintroducing wild-type or mutated versions of yjcH into deletion strains to assess functional restoration, similar to approaches used with YajC .

  • Synthetic lethality screening: Identifying genes that become essential in a yjcH deletion background can reveal functional networks and redundant pathways. This approach revealed the synthetic lethality between YhcB and RodZ .

  • Fusion reporter systems: Creating translational fusions with fluorescent proteins to monitor localization and expression levels in living cells.

The protocol for generating markerless deletions typically involves:

  • Amplifying flanking regions of the target gene

  • Creating a suicide vector containing these regions

  • Selecting for single crossover integrants

  • Counter-selecting for double crossover events that excise the gene of interest

  • Confirmation via PCR using check primers that bind to regions outside the deletion construct

How can I correlate yjcH structure with its potential cellular functions?

Establishing structure-function relationships for yjcH requires an integrated approach:

  • Structural prediction and modeling: Using AlphaFold or RoseTTAFold to generate structural models based on sequence, followed by molecular dynamics simulations to assess stability and potential binding sites.

  • Site-directed mutagenesis: Systematically mutating conserved residues or predicted functional domains followed by phenotypic analysis to identify critical regions.

  • Chimeric protein analysis: Creating fusion proteins between yjcH and related membrane proteins (like YhcB) to identify which domains are responsible for specific functions.

  • Suppressor mutation screening: In yjcH mutant strains showing clear phenotypes, identifying secondary mutations that restore function can reveal functional pathways.

  • Comparative genomics: Analyzing the conservation and co-evolution patterns of yjcH across bacterial species can provide insights into its functional networks.

Based on studies of related proteins, yjcH may participate in multi-protein complexes involved in cell envelope biogenesis, similar to how YhcB interacts with RodZ and other proteins involved in peptidoglycan synthesis and cell shape determination .

What biofilm-related phenotypes might be associated with yjcH based on knowledge of similar membrane proteins?

Membrane proteins like YajC have been shown to play significant roles in biofilm formation. For yjcH, potential biofilm-related phenotypes to investigate include:

  • Initial cell adherence: YajC deletion has been shown to reduce initial cell attachment to surfaces, especially after washing with PBS, suggesting proteins involved in adherence are loosely attached to the cell surface in the mutant . Similar phenotypes might be observed with yjcH mutants.

  • Biofilm thickness and biomass: Quantitative analysis using confocal laser scanning microscopy (CLSM) can reveal differences in biofilm structure between wild-type and yjcH mutants, as demonstrated for YajC .

  • Cell viability within biofilms: Live/dead staining within biofilms might reveal altered patterns of cell death in yjcH mutants compared to wild-type, similar to observations with YajC where mutants showed reduced numbers of dead cells in biofilms .

  • Flow cell behavior: Performance in dynamic flow cell models may differ from static models, providing insights into the role of yjcH in biofilm development under shear stress conditions.

  • Extracellular polymeric substance (EPS) production: Analysis of extracellular matrix components may reveal alterations in polysaccharide or protein composition in yjcH mutants.

Experimental approach should include both static and dynamic biofilm models, with quantification using COMSTAT analysis software to measure parameters like biomass, average thickness, and surface coverage .

What are the most promising future research directions for understanding yjcH function?

Based on current knowledge of related membrane proteins, several promising research directions for yjcH include:

  • Comprehensive interaction mapping: Using approaches like BACTH screening, proximity labeling (BioID), or pull-down proteomics to identify the complete interactome of yjcH, similar to studies that revealed YhcB interactions with cell shape proteins .

  • Synthetic genetic array (SGA) analysis: Systematically crossing yjcH deletion with genome-wide deletion libraries to identify genetic interactions and potential functional pathways.

  • Cryo-EM structural studies: Determining high-resolution structures of yjcH alone and in complex with interaction partners to elucidate mechanistic details.

  • Role in antimicrobial resistance: Investigating whether yjcH contributes to membrane permeability or antibiotic tolerance, particularly since membrane proteins involved in cell envelope biogenesis can influence susceptibility to cell wall-targeting antibiotics.

  • Comparative genomics across pathogenic strains: Analyzing the conservation and variation of yjcH across clinical isolates to determine potential connections to virulence or host adaptation.

Integrating these approaches with systems biology methods could reveal the broader cellular context in which yjcH functions, potentially identifying it as a new antimicrobial target if it proves essential for cell envelope integrity or biofilm formation in pathogenic strains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.