Recombinant Escherichia coli Inner membrane protein yjeO (yjeO)

Shipped with Ice Packs
In Stock

Description

Introduction to YjeQ (Potential Analog to yjeO)

YjeQ is a conserved GTPase in E. coli essential for bacterial viability. It belongs to a family of nucleotide-binding proteins with roles in ribosome function and translation regulation. While "yjeO" is not documented in the provided literature, YjeQ is well-studied, and its properties may align with the user’s query.

Biochemical Properties and Functional Roles

YjeQ exhibits:

  • GTPase Activity: Slow steady-state hydrolysis (~8 h⁻¹), but rapid catalysis (100 s⁻¹) when bound to ribosomes .

  • Ribosome Interaction: Binds the 30S subunit, with GTP-dependent stimulation of GTPase activity (160-fold increase) .

  • Structural Domains:

    • OB-fold region: Critical for ribosome binding and GTPase stimulation.

    • N-terminal peptide (aa 1–20): Required for GMP-PNP-dependent interaction with the 30S subunit .

PropertyYjeQReference
GTPase activity (basal)8 h⁻¹
GTPase activity (ribosome-bound)160-fold stimulation
Ribosome binding affinityStrong (30S subunit)
Essentiality in E. coliYes (growth defect upon deletion)

Mechanistic Insights from Recombinant Studies

Recombinant YjeQ has been purified and characterized in vitro:

  • Purification: Expressed in E. coli with a His₆ tag, followed by TEV protease cleavage .

  • Functional Assays:

    • GTP Hydrolysis: Measured via thin-layer chromatography (TLC) or radiometric methods.

    • Ribosome Binding: Assessed via co-purification with ribosomes and salt-wash stringency tests .

Recombinant Production Challenges

While YjeQ’s recombinant production is not explicitly detailed in the provided sources, general E. coli strategies apply:

  • Strain Selection: BL21(DE3) or Walker strains (e.g., C41, C43) for membrane protein production .

  • Plasmid Design:

    • Promoters: T7, lac, or araBAD systems (e.g., pET, pBAD vectors) .

    • Copy Number: Low-copy vectors (e.g., p15A) reduce metabolic burden .

Potential Role in Translation and Stress Response

YjeQ’s interaction with ribosomes suggests a role in:

  • Translation Regulation: Modulating ribosome activity during stress or resource limitation.

  • Stress Tolerance: Coordinating ribosome function with cellular energy states via GTP hydrolysis .

Research Gaps and Future Directions

  • Structural Elucidation: High-resolution structures of YjeQ-ribosome complexes remain unresolved.

  • Functional Links: Mechanistic connections to translation fidelity, mRNA degradation, or antibiotic resistance require further study.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
The delivery time may vary depending on the purchase method and location. For precise delivery times, please consult your local distributors.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
yjeO; b4158; JW4119; Inner membrane protein YjeO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-104
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
yjeO
Target Protein Sequence
MSARMFVLCCIWFIVAFLWITITSALDKEWMIDGRGINNVCDVLMYLEEDDTRDVGVIMT LPLFFPFLWFALWRKKRGWFMYATALAIFGYWLWQFFLRYQFCL
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of YjeO in E. coli?

YjeO is an inner membrane protein in E. coli with characteristics similar to other inner membrane proteins that have transmembrane motifs. While specific structural data for YjeO is limited, research on comparable inner membrane proteins such as YqjD indicates these proteins typically contain transmembrane helices that anchor them to the inner membrane . Based on studies of similar proteins, YjeO likely possesses alpha-helical transmembrane domains characteristic of inner membrane proteins in gram-negative bacteria . Functionally, YjeO may be involved in membrane integrity, protein transport across membranes, or signal transduction, though specific functions would require targeted experimental verification.

How does YjeO compare to other characterized inner membrane proteins like YqjD?

YjeO shares the fundamental characteristic of membrane localization with other E. coli inner membrane proteins like YqjD. YqjD has been well-characterized as possessing a transmembrane motif in its C-terminal region (residues 77-98) and associates with 70S and 100S ribosomes at its N-terminal region . YqjD's expression is regulated by the stress response sigma factor RpoS and increases during stationary phase . A comparative analysis of YjeO would involve examining whether it shares these properties: Does it bind to ribosomes? Is its expression growth-phase dependent? Is it regulated by specific sigma factors? These comparative analyses would be essential for positioning YjeO within the functional landscape of E. coli inner membrane proteins.

What protein families or domains is YjeO associated with?

To properly characterize YjeO's protein family associations, researchers should conduct bioinformatic analyses using tools like PFAM, InterPro, or SMART to identify conserved domains. Similar inner membrane proteins in E. coli, such as YqjD, ElaB, and YgaM, form paralogous families with shared functional characteristics . If YjeO contains transmembrane motifs similar to these proteins, secondary structure prediction tools like SOSUI (http://bp.nuap.nagoya-u.ac.jp/sosui/) can be employed to identify these regions. Phylogenetic analysis comparing YjeO sequences across different bacterial species would provide insights into evolutionary conservation and potentially reveal functional importance.

What are the most effective expression systems for producing recombinant YjeO?

For efficient expression of membrane proteins like YjeO, specialized E. coli strains such as SuptoxR and its second-generation variants (SuptoxR2.1 and SuptoxR2.2) offer significant advantages . These engineered strains can suppress the toxicity typically associated with membrane protein overexpression while enhancing the accumulation of properly folded proteins in the membrane . For YjeO expression, researchers should consider:

  • Using a vector system with tunable expression control (e.g., pET or pBAD)

  • Co-expressing effector genes like rraA, which has been shown to enhance membrane protein production

  • Testing expression in multiple SuptoxR variants, as different RraA proteins (from P. mirabilis and P. stuartii) may provide optimal results for different membrane proteins

  • Monitoring expression using GFP fusion constructs to assess membrane integration efficiency

When implementing these strategies, researchers should optimize induction conditions (temperature, inducer concentration, induction time) to maximize yield while minimizing toxicity.

How can researchers verify proper membrane localization of recombinant YjeO?

Proper membrane localization of YjeO can be verified through multiple complementary approaches:

  • Differential centrifugation: Using protocols similar to those employed for YqjD characterization, cells should be lysed and subjected to differential centrifugation to separate membrane fractions from cytosolic components . Inner and outer membranes can be separated with techniques like sucrose gradient centrifugation.

  • Fluorescence microscopy: Construction of YjeO-GFP fusion proteins allows for visualization of membrane localization patterns in living cells. Whole-cell fluorescence measurements can also provide quantitative data on expression levels .

  • Western blotting analysis: After membrane fractionation, Western blotting with antibodies against YjeO or an epitope tag can confirm presence in the inner membrane fraction .

  • Protease accessibility assays: Limited proteolysis of spheroplasts versus intact cells can determine the topology of YjeO transmembrane segments.

Successful membrane localization would be indicated by co-fractionation with known inner membrane markers and protection from protease digestion in intact cells but not in membrane preparations.

What purification strategies yield highest purity and stability for YjeO?

Purification of inner membrane proteins like YjeO requires specialized approaches:

  • Extraction optimization: Screen multiple detergents (DDM, LDAO, FC-12) at various concentrations to identify optimal solubilization conditions that maintain protein stability.

  • Affinity chromatography: Utilize affinity tags (His6, FLAG, Strep-II) positioned to minimize interference with membrane insertion. N-terminal tags are often preferred for inner membrane proteins with N-terminus facing the cytoplasm .

  • Size exclusion chromatography: Essential for removing aggregates and ensuring homogeneity of the purified protein-detergent complexes .

  • Quality assessment: Analyze purified YjeO using SDS-PAGE, Western blotting, and biophysical methods like circular dichroism to confirm proper folding. For membrane proteins like HtdR, typical yields of ~5 mg of pure protein per liter of shake flask culture have been reported using optimized SuptoxR strains .

Stability of purified YjeO can be enhanced by screening various buffer conditions, including pH ranges, salt concentrations, and stabilizing additives like glycerol or specific lipids.

How does YjeO interact with the ribosome and what methods best characterize these interactions?

If YjeO shares functional characteristics with YqjD, which associates with 70S and 100S ribosomes, researchers should investigate potential YjeO-ribosome interactions using these methodologies:

  • Co-sedimentation assays: Isolate ribosomes from cells expressing YjeO and analyze co-purifying proteins by mass spectrometry or Western blotting .

  • Cross-linking studies: Use chemical cross-linkers followed by mass spectrometry to identify interaction sites between YjeO and ribosomal components.

  • Cryo-electron microscopy: For structural characterization of YjeO-ribosome complexes at high resolution.

  • Ribosome profiling: Determine if YjeO affects ribosome positioning on mRNAs or translation efficiency.

  • Mutational analysis: Create deletion variants (similar to ΔC-YqjD and ΔN-YqjD constructs) to map regions responsible for ribosome binding .

Researchers should examine whether YjeO, like YqjD, preferentially associates with 70S and 100S ribosomes during stationary phase, which would suggest a role in modulating translation during stress conditions.

What role might YjeO play in stress response pathways similar to YqjD?

To investigate YjeO's potential role in stress response:

  • Promoter analysis: Examine the YjeO promoter region for RpoS binding sites or other stress-response elements using bioinformatic tools.

  • Expression profiling: Use qRT-PCR and Western blotting to monitor YjeO expression levels under various stress conditions (nutrient limitation, oxidative stress, pH stress, temperature shifts).

  • Deletion mutant phenotyping: Create and characterize ΔyjeO deletion mutants similar to the ΔyqjD strain from the Keio collection . Compare growth curves, stress tolerance, and ribosome profiles of wild-type and mutant strains.

  • Multi-omics analysis: Perform transcriptomic, proteomic, and metabolomic analyses of ΔyjeO mutants versus wild-type under different growth conditions to identify affected pathways.

  • Complementation studies: Determine whether YqjD can compensate for YjeO deletion or vice versa, which would suggest functional overlap.

If YjeO expression is regulated by RpoS like YqjD, researchers should observe increased expression during stationary phase and in response to specific stressors .

How can researchers determine the topology and transmembrane organization of YjeO?

Determining YjeO's membrane topology requires multiple complementary approaches:

  • Computational prediction: Use specialized algorithms like TMHMM, SOSUI, and Phobius to predict transmembrane segments and their orientation .

  • Reporter fusion analysis: Create systematic fusions of YjeO fragments with reporters like PhoA (active in periplasm) and GFP (active in cytoplasm) to map segment localization.

  • Cysteine scanning mutagenesis: Introduce single cysteines throughout YjeO and probe their accessibility to membrane-impermeable sulfhydryl reagents.

  • Protease protection assays: Determine which regions are protected from proteolytic digestion in membrane preparations.

  • Structural studies: For definitive topology determination, pursue structural characterization using techniques like X-ray crystallography, cryo-EM, or NMR spectroscopy of purified protein.

For comparison, YqjD has been shown to possess a transmembrane motif in its C-terminal region (residues 77-98) , and researchers should investigate whether YjeO exhibits similar organizational features.

How can researchers address toxicity issues during YjeO overexpression?

Membrane protein overexpression often causes toxicity, as documented with other inner membrane proteins. To overcome this challenge:

  • Strain selection: Use specialized expression strains like SuptoxR, SuptoxR2.1, or SuptoxR2.2, which are engineered specifically to suppress membrane protein-induced toxicity .

  • Co-expression strategies: Co-express RraA variants alongside YjeO, as this has been shown to reduce toxicity and enhance production of other membrane proteins . The RraA proteins from P. mirabilis and P. stuartii have demonstrated even greater efficacy than E. coli RraA for some membrane proteins .

  • Expression conditions: Lower induction temperature (16-25°C), reduce inducer concentration, and use rich media formulations to mitigate stress responses.

  • Inducible promoters: Employ tightly regulated promoters that allow precise control over expression levels.

  • Fusion constructs: Test different fusion tags and their positions, as these can significantly impact toxicity and expression yields.

The toxicity observed with YqjD overexpression led to growth inhibition , and similar effects might be anticipated with YjeO overexpression if the proteins share functional characteristics.

What methods can resolve contradictory data about YjeO localization or function?

When facing contradictory results regarding YjeO localization or function:

  • Validate antibody specificity: Ensure antibodies used for detection are specific by including appropriate controls (ΔyjeO strains) and comparing multiple antibody preparations.

  • Control for expression levels: Contradictions may arise from different expression levels affecting localization; use native promoter constructs versus overexpression systems.

  • Growth condition standardization: Rigorously standardize growth conditions, as membrane protein localization can be highly dependent on growth phase and environmental factors .

  • Complementary approaches: Always use multiple, orthogonal techniques to verify findings:

    • Microscopy + biochemical fractionation

    • In vivo + in vitro studies

    • Genetic + biochemical methods

  • Strain-specific effects: Test in multiple E. coli strains as background mutations can affect results.

  • Interaction partner verification: For protein-protein interactions, use reciprocal pull-downs, Y2H assays, and FRET to confirm direct interactions.

If contradictions persist, consider whether YjeO might have multiple localizations or functions depending on cellular context, similar to how YqjD associates with both ribosomes and membranes .

How can researchers accurately quantify YjeO expression levels in different growth conditions?

For accurate quantification of YjeO expression:

  • Quantitative Western blotting: Use purified recombinant YjeO as a standard curve for absolute quantification. Include loading controls like total protein staining or housekeeping proteins.

  • Mass spectrometry: Employ targeted proteomics approaches like SRM/MRM (Selected/Multiple Reaction Monitoring) with isotopically labeled peptide standards for absolute quantification.

  • Fluorescent reporter fusions: Create chromosomal YjeO-GFP fusions at the native locus to maintain natural expression control while enabling quantification .

  • qRT-PCR: Measure transcript levels with carefully validated primers and reference genes.

  • Single-cell analysis: Use flow cytometry or fluorescence microscopy with reporter fusions to assess population heterogeneity in expression.

Researchers should monitor YjeO expression across growth phases similar to the analysis performed for YqjD, which showed maximal expression at 2 days in stationary phase . This time-course approach will reveal whether YjeO expression follows similar growth phase-dependent patterns.

What emerging technologies might advance our understanding of YjeO function and interactions?

Several cutting-edge technologies hold promise for YjeO research:

  • Cryo-electron tomography: For visualizing YjeO in its native membrane environment at near-atomic resolution.

  • Proximity labeling methods: Techniques like BioID or APEX2 can identify proteins in close proximity to YjeO in vivo, revealing potential interaction networks.

  • Native mass spectrometry: Emerging methods allow analysis of intact membrane protein complexes in native-like detergent micelles.

  • Single-molecule tracking: To monitor YjeO dynamics within the membrane in real-time.

  • High-throughput mutagenesis: CRISPR-based approaches combined with deep sequencing can map functional residues across the entire protein.

  • Nanobodies and synthetic binding proteins: Development of specific binders for YjeO could enable new purification strategies and functional studies.

  • Microfluidic techniques: For precise control of cellular environments while monitoring YjeO expression and localization.

Researchers should consider integrating these technologies with traditional approaches to develop a comprehensive understanding of YjeO's role in cellular physiology.

How might YjeO function relate to broader cellular processes like stress response or antibiotic resistance?

To investigate YjeO's potential involvement in broader cellular processes:

  • Phenotypic screening: Test ΔyjeO mutants for altered sensitivity to various antibiotics, stress conditions, and growth environments.

  • Genetic interaction mapping: Perform synthetic genetic array analysis with ΔyjeO to identify genes with functional relationships.

  • Transcriptional response analysis: Examine global transcriptional changes in ΔyjeO mutants using RNA-seq under various conditions.

  • Metabolic flux analysis: Determine whether YjeO deletion affects metabolic pathways, particularly those related to membrane function.

  • Interspecies comparison: Compare phenotypes of YjeO homolog deletions across different bacterial species to identify conserved functions.

If YjeO functions similarly to YqjD, it may play a role in adapting ribosomes to membrane locations during stress conditions , potentially affecting translation of specific mRNAs involved in stress response or antibiotic resistance.

What methodological approaches are needed to determine the potential role of YjeO in ribosome localization to the membrane?

To investigate whether YjeO, like YqjD, plays a role in localizing ribosomes to the membrane:

  • Fluorescence co-localization: Use dual-color fluorescence microscopy with labeled ribosomes and YjeO to track co-localization patterns during different growth phases.

  • Membrane-ribosome fractionation: Develop refined protocols to isolate membrane-bound ribosomes and analyze YjeO association.

  • Domain mapping experiments: Create deletion constructs of YjeO (similar to ΔC-YqjD and ΔN-YqjD) to identify regions required for ribosome and membrane interactions .

  • Translation activity assays: Compare translation efficiency of membrane-bound versus free ribosomes in wild-type and ΔyjeO strains.

  • Ribosome profiling of membrane fractions: Identify which mRNAs are preferentially translated by membrane-associated ribosomes and how YjeO affects this distribution.

  • Electron microscopy: Use immunogold labeling to visualize the spatial relationship between YjeO and ribosomes at the inner membrane.

The hypothesis that YjeO might localize ribosomes to the membrane, similar to YqjD , represents an important research direction that could reveal fundamental mechanisms of protein synthesis regulation during stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.