Recombinant Escherichia coli Inner membrane protein ykgB (ykgB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
rclC; ykgB; b0301; JW5038; Inner membrane protein RclC; Reactive chlorine resistance protein C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
rclC
Target Protein Sequence
MEKYLHLLSRGDKIGLTLIRLSIAIVFMWIGLLKFVPYEADSITPFVANSPLMSFFYEHP EDYKQYLTHEGEYKPEARAWQTANNTYGFSNGLGVVEVIIALLVLANPVNRWLGLLGGLM AFTTPLVTLSFLITTPEAWVPALGDAHHGFPYLSGAGRLVLKDTLMLAGAVMIMADSARE ILKQRSNESSSTLKTEY
Uniprot No.

Target Background

Function
Putative involvement in reactive chlorine species (RCS) stress resistance.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ykgB protein in Escherichia coli?

YkgB (also known as rclC) is an inner membrane protein in Escherichia coli that plays a crucial role in oxidative stress response, particularly against chlorine-induced damage. It is part of the ykgCIB operon which is significantly upregulated during exposure to oxidative agents like chlorine . The protein has been identified as a "Reactive chlorine resistance protein C," highlighting its protective function against reactive chlorine species . Similar to other membrane proteins involved in stress response, ykgB is part of the cellular defense mechanism that helps E. coli survive environmental stressors, particularly oxidative challenges.

How is expression of ykgB regulated in E. coli?

The expression of ykgB is primarily regulated in response to oxidative stress. As part of the ykgCIB operon, its transcription is significantly upregulated when E. coli is exposed to oxidative agents, particularly chlorine treatments . This regulation mechanism is similar to other stress-response genes in E. coli, which are often controlled by stress-specific transcription factors. While not explicitly stated in the available data, based on similar inner membrane proteins like YqjD, there's a possibility that ykgB expression might also be influenced by the stationary growth phase and potentially regulated by stress response sigma factors like RpoS . The gene is located at locus b0301 in the E. coli genome, and is also identified as JW5038 in some strain annotations .

What are the standard methods for expressing recombinant ykgB protein?

The expression of recombinant ykgB protein typically follows standard protocols for E. coli membrane proteins, with some specific considerations:

  • Expression System Selection: The T7 expression system in pET vectors is commonly used, as it can represent up to 50% of total cell protein in successful cases . For ykgB specifically, expression in E. coli is the preferred method, with the protein typically fused to an N-terminal His-tag for purification purposes .

  • Growth Conditions: Culture at 37°C in LB media is standard, though for membrane proteins like ykgB, lower temperatures (18-30°C) may improve proper folding.

  • Induction Protocol: For T7-based systems, IPTG induction is used. Typically, cultures are grown to an OD600 of 0.4-0.6 before induction with IPTG (commonly at 0.4mM) for 4 hours .

  • Cell Harvest and Lysis: Cells are harvested by centrifugation and lysed using buffer systems containing protease inhibitors to prevent degradation of the target protein.

  • Storage: The purified protein is often stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, and it's recommended to add 5-50% glycerol for long-term storage at -20°C/-80°C .

What are common challenges in purifying recombinant ykgB protein?

Purifying recombinant ykgB presents several challenges common to membrane proteins:

  • Solubilization: As an inner membrane protein, ykgB requires careful solubilization with appropriate detergents. This is typically done after cell lysis and membrane fraction isolation.

  • Maintaining Protein Integrity: Membrane proteins like ykgB can easily denature during purification. Using appropriate buffers and detergents at each step is crucial for maintaining proper folding.

  • Membrane Fraction Isolation: The fractionation of inner membrane proteins requires differential centrifugation techniques. First, cell debris is removed by low-speed centrifugation (e.g., 4,000 rpm for 5 min), followed by high-speed centrifugation (e.g., 50,000 rpm for 1.5 h) to isolate membrane proteins. Inner and outer membrane proteins are then separated using sucrose gradient centrifugation .

  • Purification Strategy: A multi-step purification approach is typically required:

    • Initial capture using affinity chromatography (His-tag)

    • Further purification using ion exchange chromatography (e.g., Sepharose Q FF column)

    • Final polishing using size exclusion chromatography

  • Freeze-Thaw Stability: Repeated freezing and thawing is not recommended for ykgB, and working aliquots should be stored at 4°C for up to one week .

How does ykgB contribute to chlorine resistance mechanisms in E. coli?

YkgB (rclC) plays a significant role in E. coli's defense against chlorine stress through several potential mechanisms:

  • Oxidative Damage Repair: Gene expression studies show the ykgCIB operon is significantly upregulated during chlorine exposure, suggesting its involvement in repairing oxidative damage caused by chlorine . This is supported by its annotation as "Reactive chlorine resistance protein C."

  • Membrane Integrity Maintenance: As an inner membrane protein, ykgB likely contributes to maintaining membrane integrity during oxidative stress. Chlorine can damage membrane components through oxidation, and ykgB may be involved in counteracting these effects.

  • Strain-Specific Resistance Variation: Different E. coli strains show varying levels of chlorine resistance, with strains from clade 8 demonstrating higher resistance than those from clade 6 . The expression levels and genetic variations of ykgB across these strains may contribute to these differences.

  • Integration with Other Defense Systems: YkgB likely works in coordination with other oxidative stress response systems including:

    • SOD (superoxide dismutase) genes (sodABC)

    • Catalase genes (katE and katG)

    • Alkyl hydroperoxide reductase genes (ahpF and ahpC)

The specific molecular mechanisms remain an active area of research, but experimental evidence strongly suggests ykgB is a key component of the cellular defense against chlorine-induced oxidative stress.

What are the most effective methods for studying ykgB membrane topology?

Studying the membrane topology of ykgB requires specialized techniques designed for membrane proteins:

  • Cysteine Scanning Mutagenesis: This technique involves:

    • Introducing cysteine residues at various positions in the ykgB sequence

    • Testing accessibility of these cysteines to membrane-impermeable sulfhydryl reagents

    • Positions accessible to these reagents are exposed to the periplasm

  • Computational Prediction with Experimental Validation: Using programs like TMHMM for initial prediction of transmembrane segments, followed by experimental validation. For ykgB, TMHMM predicts multiple transmembrane helices that can be verified experimentally .

How can I design experiments to study the role of ykgB in oxidative stress response?

To investigate ykgB's role in oxidative stress response, consider these experimental approaches:

  • Gene Knockout Studies:

    • Create a ykgB deletion mutant using lambda Red recombineering or CRISPR-Cas9

    • Compare growth rates of wild-type and ΔykgB strains under various oxidative stress conditions

    • Test survival rates after exposure to increasing concentrations of chlorine (e.g., 3.0-5.0 μl/ml sodium hypochlorite)

    • Measure lag phase extension as an indicator of stress sensitivity

  • Complementation Experiments:

    • Transform the ykgB knockout strain with a plasmid expressing wild-type ykgB

    • Test if this restores normal resistance to oxidative stress

    • Create point mutations in key domains to identify essential residues

  • Gene Expression Analysis:

    • Use qPCR or RNA-seq to measure ykgB expression under various oxidative stress conditions

    • Track expression over time to determine activation kinetics

    • Compare expression patterns with other known oxidative stress genes

  • Protein Interaction Studies:

    • Perform pull-down assays using His-tagged ykgB to identify interaction partners

    • Use crosslinking approaches to capture transient interactions

    • Conduct bacterial two-hybrid screens to identify potential regulatory proteins

  • Oxidative Damage Assays:

    • Measure lipid peroxidation levels in wild-type vs. ΔykgB strains

    • Assess protein carbonylation as a marker of oxidative damage

    • Measure intracellular ROS levels using fluorescent probes

What protein-protein interactions have been identified for ykgB?

While specific protein-protein interactions for ykgB have not been extensively characterized in the provided search results, several approaches can be used to identify potential interaction partners:

  • Predictive Analysis Based on Similar Proteins: Similar inner membrane proteins like YqjD have been shown to associate with ribosomes, specifically 70S and 100S ribosomes . Given the functional similarity in stress response, ykgB might interact with similar cellular components.

  • Potential Interaction Categories:

    • Oxidative stress response proteins: Given ykgB's role in chlorine resistance, it likely interacts with components of oxidative stress response pathways

    • Membrane protein complexes: ykgB may form complexes with other membrane proteins involved in stress response

    • Ribosomal components: If ykgB functions similarly to YqjD, it might interact with ribosomal proteins

  • Experimental Methods for Interaction Discovery:

    • Affinity Purification coupled with Mass Spectrometry (AP-MS): Using His-tagged ykgB to pull down interaction partners

    • Bacterial Two-Hybrid Screening: To detect direct protein-protein interactions

    • Co-immunoprecipitation: With antibodies against ykgB or potential partners

    • Crosslinking studies: To capture transient interactions in the membrane environment

  • Interaction Validation Methods:

    • Reciprocal co-immunoprecipitation

    • Fluorescence resonance energy transfer (FRET)

    • Surface plasmon resonance (SPR)

    • Isothermal titration calorimetry (ITC)

How do expression and function of ykgB compare across different E. coli strains?

The expression and function of ykgB vary significantly across different E. coli strains, particularly in relation to stress resistance:

  • Strain-Specific Chlorine Resistance:
    Different E. coli clades show varying levels of chlorine resistance, which may correlate with ykgB function:

    • Strains from clade 8 (including TW14359) demonstrate higher chlorine resistance

    • Strains from clade 6 show the least resistance to chlorine treatment

    • These differences are reflected in lag phase extension times ranging from 6.05 to 10.61 hours when exposed to chlorine

    CladeRepresentative StrainAvg. Lag Phase Extension (h)Chlorine Resistance
    8TW143597.70Highest
    5Various~8.32High
    3EDL-933~8.10Moderate
    1Sakai~8.28Moderate
    6Various~9.71Lowest
  • Genomic Conservation:

    • The ykgB gene (b0301, JW5038) is conserved across various E. coli strains

    • Similar genes are found in related bacteria, suggesting evolutionary importance

    • Genomic location and context may vary between strains, potentially affecting regulation

  • Expression Variation:

    • Baseline expression levels of ykgB vary between strains

    • Induction patterns under oxidative stress differ substantially

    • Pathogenic strains like E. coli O157:H7 show specific expression patterns related to virulence and stress resistance

  • Functional Conservation:

    • The core function in oxidative stress response appears conserved across strains

    • Specific mechanisms and efficiency may vary

    • Integration with strain-specific stress response pathways differs

What advanced analytical techniques can be used to study the structure-function relationship of ykgB?

Several sophisticated analytical techniques can elucidate the structure-function relationship of ykgB:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Allows visualization of membrane proteins in near-native states

    • Can reveal detailed structural information without crystallization

    • Particularly useful for ykgB as membrane proteins are challenging to crystallize

    • Can potentially reveal conformational changes under different conditions

  • Site-Directed Mutagenesis Combined with Functional Assays:

    • Create systematic mutations in key domains of ykgB

    • Test each mutant for:

      • Chlorine resistance capability

      • Membrane localization

      • Protein-protein interactions

    • This approach can identify critical residues for function

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Probes protein dynamics and solvent accessibility

    • Can identify regions of ykgB that undergo conformational changes upon oxidative stress

    • Provides insight into which domains are involved in stress response

  • Solid-State NMR:

    • Can provide atomic-level structural information on membrane proteins

    • Allows study of ykgB in a lipid environment mimicking the native membrane

    • Can identify dynamic regions and structural changes

  • Molecular Dynamics Simulations:

    • Computational approach to model ykgB behavior in membrane environments

    • Can predict:

      • Conformational changes under stress conditions

      • Interaction with lipids and other membrane components

      • Potential binding sites for other proteins or small molecules

    • Results can guide experimental design for validation

  • Cross-Linking Mass Spectrometry (XL-MS):

    • Identifies spatial relationships between protein domains

    • Can map contact points between ykgB and interaction partners

    • Particularly useful for understanding how ykgB interacts with the oxidative stress response machinery

These advanced techniques, when used in combination, can provide comprehensive insights into how ykgB's structure enables its function in oxidative stress response.

What is the optimal protocol for purifying recombinant ykgB protein for structural studies?

For structural studies of recombinant ykgB, an optimized purification protocol is essential:

  • Expression Optimization:

    • Transform E. coli expression strain (preferably BL21(DE3) or derivatives) with a plasmid containing ykgB with N-terminal His-tag

    • Grow cultures in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.4-0.6

    • Induce with 0.4 mM IPTG and continue growth at a reduced temperature (18-25°C) for 16-18 hours to enhance proper folding

  • Cell Harvest and Lysis:

    • Harvest cells by centrifugation at 4,000g for 20 minutes at 4°C

    • Resuspend in lysis buffer: 50 mM Tris-HCl pH 8.0, 200 mM NaCl, 5 mM EDTA, with protease inhibitor cocktail and DNase

    • Lyse cells using either sonication or high-pressure homogenization

  • Membrane Fraction Isolation:

    • Remove unlysed cells and debris by centrifugation at 10,000g for 20 minutes

    • Collect the supernatant and ultracentrifuge at 100,000g for 1.5 hours at 4°C

    • The pellet contains membrane proteins including ykgB

  • Inner Membrane Separation:

    • Resuspend the membrane pellet in TE buffer

    • Layer on a sucrose step gradient (53-70% sucrose in TE buffer)

    • Ultracentrifuge at 55,000 rpm for 5 hours at 4°C

    • Collect the upper band containing inner membrane proteins

  • Protein Solubilization:

    • Solubilize the inner membrane fraction in buffer containing an appropriate detergent (e.g., n-dodecyl-β-D-maltoside (DDM) at 1%)

    • Incubate with gentle agitation for 1-2 hours at 4°C

    • Remove insoluble material by ultracentrifugation

  • Multi-step Purification:

    • Immobilized Metal Affinity Chromatography (IMAC):

      • Apply solubilized protein to Ni-NTA column equilibrated with buffer containing 0.05% DDM

      • Wash extensively to remove non-specific binding

      • Elute with imidazole gradient (50-500 mM)

    • Ion Exchange Chromatography:

      • Apply pooled IMAC fractions to a Sepharose Q FF column

      • Develop with a linear gradient of 0-0.5 M NaCl

      • Pool fractions containing ykgB

    • Size Exclusion Chromatography:

      • Apply concentrated protein to Superdex 200 column

      • Collect peak fractions containing pure ykgB

  • Quality Control:

    • Assess purity by SDS-PAGE (target >95% purity)

    • Verify identity by Western blot and/or mass spectrometry

    • Check monodispersity by dynamic light scattering

  • Storage:

    • Concentrate to 5-10 mg/ml using 10 kDa cutoff concentrators

    • Add glycerol to a final concentration of 10%

    • Flash-freeze in liquid nitrogen and store at -80°C

This protocol should yield highly pure ykgB suitable for structural studies including crystallography, Cryo-EM, or NMR.

How can I design a functional assay to measure ykgB's role in chlorine resistance?

To quantitatively assess ykgB's contribution to chlorine resistance, the following functional assay can be implemented:

This comprehensive assay provides multiple metrics to quantify ykgB's specific contribution to chlorine resistance while controlling for other factors.

What are the best approaches for creating site-directed mutations in ykgB for structure-function studies?

For precise structure-function analysis of ykgB, several approaches to site-directed mutagenesis can be employed:

  • Strategic Selection of Mutation Sites:

    • Transmembrane regions: Mutate residues predicted to be at the membrane interface

    • Conserved motifs: Identify conserved amino acids across bacterial species

    • Charged residues: Focus on charged amino acids that might be involved in protein-protein interactions

    • Predicted functional domains: Target regions predicted to be involved in chlorine sensing or response

  • Gibson Assembly Mutagenesis:

    • Design primers to amplify fragments with overlapping ends containing mutations

    • Combine fragments using Gibson Assembly master mix

    • Transform assembled plasmid into competent cells

    • This method is particularly useful for creating multiple mutations simultaneously

  • CRISPR-Cas9 Genome Editing:

    • Design guide RNA targeting ykgB in the E. coli genome

    • Provide repair template containing desired mutations

    • Select for successful edits

    • This approach creates mutations in the chromosomal copy, avoiding plasmid expression artifacts

  • Alanine Scanning Mutagenesis:

    • Systematically replace amino acids with alanine

    • Create a library of mutants covering the entire protein or specific domains

    • Test each mutant for chlorine resistance function

    • Identify residues critical for function

  • Cysteine Scanning Mutagenesis:

    • Introduce cysteine residues at various positions

    • Use sulfhydryl-reactive compounds to probe accessibility

    • This approach provides both functional and topological information

  • Functional Validation Methods:

    • Complementation assays: Test if mutant ykgB can restore chlorine resistance in a ΔykgB strain

    • Protein localization: Verify that mutations don't disrupt membrane localization

    • Protein stability analysis: Ensure mutations don't destabilize the protein

    • Stress response assays: Measure chlorine resistance using the functional assays described in section 3.2

  • Data Organization and Analysis:

    • Create a comprehensive database of all mutations and their effects

    • Map results onto predicted structural models

    • Identify patterns in structure-function relationships

    • Use insights to refine hypotheses about mechanism of action

These approaches provide a systematic framework for dissecting the molecular basis of ykgB function in chlorine resistance.

How can I develop a high-throughput screening system to identify compounds that interact with ykgB?

Developing a high-throughput screening (HTS) system for ykgB-interacting compounds requires specialized approaches for membrane proteins:

  • Protein Preparation Strategies:

    • Express ykgB with affinity tags (His-tag or biotinylation tag)

    • Purify in detergent micelles or reconstitute into nanodiscs/liposomes

    • Verify functionality using established chlorine resistance assays

  • Fluorescence-Based Binding Assays:

    • Thermal Shift Assay (TSA):

      • Label purified ykgB with environmentally sensitive fluorophores

      • Measure thermal stability shifts upon compound binding

      • Optimize for 384-well format for high-throughput screening

    • Förster Resonance Energy Transfer (FRET):

      • Label ykgB with donor fluorophore

      • Label known binding partners with acceptor fluorophore

      • Screen for compounds that disrupt FRET signal

  • Surface Plasmon Resonance (SPR) Screening:

    • Immobilize His-tagged ykgB on Ni-NTA sensor chips

    • Flow compound libraries over the surface

    • Detect binding events through refractive index changes

    • Optimize for fragment-based screening approaches

  • Cell-Based Phenotypic Screens:

    • Create reporter strain where cell survival under chlorine stress depends on ykgB function

    • Screen compounds for those that either enhance or inhibit chlorine resistance

    • Secondary assays to confirm ykgB-specific effects:

      • Test compounds on ΔykgB strains

      • Verify direct binding through pull-down assays

  • Membrane Yeast Two-Hybrid System:

    • Adapt split-ubiquitin yeast two-hybrid system for ykgB

    • Screen for compounds that disrupt known protein-protein interactions

    • Use growth selection on appropriate media for high-throughput identification

  • Computational Screening Methods:

    • Develop homology models of ykgB structure

    • Use molecular docking to virtually screen compound libraries

    • Prioritize compounds based on predicted binding energy

    • Validate top hits experimentally

  • Assay Optimization Parameters:

    • Maximize signal-to-noise ratio (Z' factor >0.5)

    • Ensure reproducibility (coefficient of variation <20%)

    • Implement positive and negative controls on each plate

    • Include counter-screens to eliminate false positives

  • Data Analysis and Hit Validation:

    • Apply appropriate statistical methods for hit identification

    • Perform dose-response studies on primary hits

    • Validate binding through orthogonal methods (isothermal titration calorimetry, microscale thermophoresis)

    • Assess effects on ykgB function using the assays described in section 3.2

This HTS framework allows for the systematic identification of compounds that interact with ykgB, potentially leading to tools for studying its function or even therapeutic development targeting bacterial chlorine resistance.

What are the emerging research areas involving ykgB and other inner membrane proteins in bacterial stress response?

Current research on ykgB and related inner membrane proteins is expanding in several promising directions:

  • Systems Biology of Stress Response Networks:

    • Integration of ykgB into comprehensive models of bacterial stress response

    • Network analysis of how inner membrane proteins coordinate with cytoplasmic stress response pathways

    • Computational prediction of stress response outcomes based on protein expression levels

  • Structural Biology Advancements:

    • Application of Cryo-EM to resolve membrane protein complexes in near-native states

    • AlphaFold and other AI-based structure prediction methods applied to membrane proteins

    • Time-resolved structural studies to capture conformational changes during stress response

  • Bacterial Stress Adaptation and Evolution:

    • Study of ykgB variants across bacterial species and their correlation with environmental niches

    • Analysis of ykgB mutations that emerge during adaptation to chronic oxidative stress

    • Comparative genomics approaches to identify co-evolving stress response systems

  • Pathogen-Host Interactions:

    • Role of ykgB and similar proteins in bacterial survival during host immune response

    • How inner membrane stress response proteins contribute to pathogen persistence

    • Potential targeting of these systems for antimicrobial development

  • Novel Therapeutic Approaches:

    • Design of compounds that specifically inhibit ykgB function

    • Development of adjuvants that enhance existing disinfection methods by targeting chlorine resistance mechanisms

    • Exploration of membrane protein inhibitors that sensitize bacteria to oxidative attack

  • Synthetic Biology Applications:

    • Engineering stress-resistant bacteria using optimized ykgB variants

    • Development of biosensors based on ykgB's response to oxidative agents

    • Creation of bacterial chassis with enhanced survival in industrial processes

  • Cross-Species Functional Conservation:

    • Analysis of ykgB homologs in diverse bacteria, including pathogens

    • Determination of conserved functional mechanisms across different bacterial species

    • Identification of species-specific adaptations in chlorine resistance mechanisms

These emerging research areas represent the cutting edge of investigation into how bacterial inner membrane proteins like ykgB contribute to stress response and survival mechanisms.

How might knowledge of ykgB function contribute to developing new antimicrobial strategies?

Understanding ykgB function could lead to novel antimicrobial approaches through several mechanisms:

  • Sensitization to Oxidative Disinfectants:

    • Development of compounds that specifically inhibit ykgB function

    • Creation of adjuvants that enhance chlorine-based disinfection by blocking resistance mechanisms

    • Design of combination treatments targeting multiple components of oxidative stress defense

  • Strain-Specific Targeting:

    • Exploitation of variation in ykgB structure and function between bacterial clades

    • Development of narrow-spectrum agents targeting pathogenic E. coli strains

    • Design of treatments that selectively eliminate chlorine-resistant bacterial populations

  • Biofilm Disruption Strategies:

    • Targeting ykgB to disrupt membrane integrity in biofilm-embedded bacteria

    • Creating combination therapies that simultaneously attack biofilm structure and impair oxidative stress resistance

    • Developing compounds that penetrate biofilms and inhibit ykgB function

  • Anti-virulence Approaches:

    • Identifying connections between ykgB-mediated stress resistance and virulence factor expression

    • Developing anti-virulence compounds that don't kill bacteria but reduce pathogenicity

    • Creating treatments that specifically target stress response systems during host infection

  • Potentiators for Existing Antibiotics:

    • Discovering compounds that inhibit ykgB and increase susceptibility to existing antibiotics

    • Developing synergistic combinations of membrane-targeting antibiotics and ykgB inhibitors

    • Creating strategies to overcome antibiotic resistance through stress response disruption

  • Host Immune Response Enhancement:

    • Understanding how ykgB helps pathogens resist host-generated oxidative attack

    • Developing immunomodulatory approaches that enhance oxidative killing by neutrophils

    • Creating treatments that simultaneously boost immune response and inhibit bacterial defense

  • Rational Design of Improved Disinfectants:

    • Engineering new disinfectants that specifically overcome ykgB-mediated protection

    • Developing oxidative compounds that bacteria cannot effectively resist

    • Creating targeted disinfection strategies for resistant bacterial populations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.