Recombinant Escherichia coli Inner membrane protein ylaC (ylaC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ylaC; b0458; JW5063; Inner membrane protein YlaC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Escherichia coli (strain K12)
Target Names
ylaC
Target Protein Sequence
MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVAFFATLAVMLQSETLS GSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWYNTRFVPAALVEAILNS PRVADVHKEQLQKMIVRKGELSFYDIFTLARAESTS
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the conserved inner membrane protein ElyC/YcbC in Escherichia coli?

ElyC (also known as YcbC) is a conserved inner membrane protein in Escherichia coli that plays a crucial role in bacterial cell wall assembly. Research has identified it as an important factor in coordinating the synthesis of multiple cell envelope components, including peptidoglycan and Enterobacterial Common Antigen (ECA) . The protein is embedded in the inner membrane and functions as a regulator of various cell wall biosynthetic pathways, making it essential for maintaining proper cell envelope integrity in gram-negative bacteria .

How does ElyC disruption affect bacterial cell viability?

Disruption of the ElyC gene leads to significant changes in cell wall assembly and composition. When the gene is deleted (ΔelyC mutants), bacteria exhibit altered phenotypes compared to wild-type cells. Studies have shown that these mutants display changes in cell morphology and integrity due to compromised cell wall structure . The absence of ElyC appears to dysregulate multiple cell envelope biosynthetic pathways, ultimately affecting bacterial survival under various growth conditions. The viability defects observed in ΔelyC mutants highlight the essential nature of this protein for proper bacterial cell function .

What is the relationship between ElyC and other cell envelope components?

ElyC coordinates the synthesis of multiple cell envelope components, demonstrating interconnected regulation between:

  • Enterobacterial Common Antigen (ECA) synthesis

  • Peptidoglycan (PG) assembly

  • Colanic acid production

Research indicates that disruption of ElyC affects the expression of genes involved in these pathways, suggesting a coordinated regulatory role for this membrane protein . This coordination is essential for maintaining envelope integrity and proper cell division in E. coli.

What experimental approaches are effective for studying ElyC function in E. coli?

To investigate ElyC function, researchers have employed several sophisticated methodological approaches:

  • Gene Deletion Studies: Creating ΔelyC mutants through precise genetic engineering to analyze resulting phenotypes.

  • Transcriptional Analysis: Measuring gene expression changes in related pathways when ElyC is absent using RT-PCR or RNA-seq technologies.

  • Growth Phenotype Characterization: Comparing growth patterns of wild-type and mutant strains under various conditions.

  • CPRG Rapid Test: A specialized assay used to evaluate envelope integrity in various strains .

  • Comparative Analysis: Studying multiple mutants (ΔelyC, ΔmrcB, ΔrfE) to understand the interconnected nature of envelope biogenesis pathways .

How does ElyC disruption affect transcriptional patterns of cell wall components?

Transcriptional analysis reveals that ElyC disruption leads to significant alterations in gene expression patterns of cell wall biosynthetic pathways. The following patterns have been observed:

Gene/Gene ClusterFunctionExpression in ΔelyC mutantCompared to wild-type
ECA gene clusterEnterobacterial Common Antigen synthesisUpregulatedOverexpressed
uppSUndecaprenyl pyrophosphate synthesisUpregulatedOverexpressed
wcaAColanic acid biosynthesisUpregulatedOverexpressed
mrcBEncodes PBP1b (peptidoglycan synthesis)AffectedExpression altered

Similar upregulation of ECA cluster, uppS, and wcaA genes was also observed in ΔmrcB mutants, further supporting the interconnection between these pathways . These expression changes suggest compensatory mechanisms activated when cell wall assembly is compromised.

What is the molecular basis for ElyC's role in coordinating cell envelope biogenesis?

The molecular mechanisms underlying ElyC's coordination of multiple biosynthetic pathways involve:

  • Membrane Localization: As an inner membrane protein, ElyC is strategically positioned to interact with biosynthetic machinery for various envelope components.

  • Pathway Cross-regulation: Evidence suggests ElyC influences the expression of genes involved in peptidoglycan synthesis, ECA production, and other envelope components .

  • Potential Scaffolding Function: While not explicitly proven, the protein may serve as a scaffold that brings together different enzymatic complexes involved in envelope biogenesis.

  • Regulatory Feedback Systems: The overexpression of ECA cluster genes in ΔelyC mutants suggests the existence of compensatory regulatory mechanisms that attempt to maintain envelope integrity when ElyC is absent .

Research demonstrates that absence of the rfE gene (involved in ECA synthesis) leads to overexpression of uppS and mrcB genes, further confirming the complex regulatory network in which ElyC participates .

How can ElyC be utilized as a potential antibacterial target?

ElyC represents a promising antibacterial target for several reasons:

  • Essential Function: Its critical role in cell envelope biogenesis makes it essential for bacterial viability.

  • Conservation: As a conserved protein in gram-negative bacteria, targeting ElyC could potentially lead to broad-spectrum antibiotics.

  • Unique to Bacteria: The protein has no human homologs, potentially reducing side effects of targeted therapeutics.

  • Accessibility: As a membrane protein, it may be more accessible to drug candidates than cytoplasmic targets.

Researchers studying ElyC as an antibacterial target should employ structure-based drug design approaches, high-throughput screening methods, and in vivo efficacy models to identify and validate potential inhibitors . As stated in the literature, "the characterisation of new envelope biogenesis factors important for Gram-negative bacteria will broaden our understanding of the bacterial cell envelope biogenesis and validate the new factors as antibacterial targets" .

What methods are optimal for expressing and purifying recombinant ElyC for structural studies?

For successful expression and purification of membrane proteins like ElyC, researchers should consider:

  • Expression Systems:

    • E. coli-based systems with specialized strains (C41, C43) designed for membrane protein expression

    • Cell-free expression systems that can directly incorporate the protein into nanodiscs or liposomes

    • Yeast expression systems for complex membrane proteins

  • Solubilization Strategies:

    • Detergent screening to identify optimal solubilization conditions

    • Membrane mimetics including nanodiscs, amphipols, or SMALPs (styrene-maleic acid lipid particles)

  • Purification Approach:

    • Affinity chromatography using carefully positioned tags that don't interfere with function

    • Size exclusion chromatography to ensure homogeneity

    • Ion exchange chromatography as a polishing step

  • Functional Validation:

    • Activity assays to confirm that the purified protein retains its native function

    • Binding studies with known interaction partners

When designing experiments for protein expression and purification, researchers must carefully control variables that might affect protein folding and stability .

How can artificial chromosome systems advance membrane protein research in bacteria?

While not directly related to ElyC, artificial chromosome technologies developed for yeast systems demonstrate principles that could be applied to bacterial membrane protein research:

  • Orthogonal Expression Platforms: Artificial chromosomes provide independent genetic elements that can express membrane proteins without interfering with host chromosome functions .

  • Multiple Gene Assembly: Complex pathways requiring multiple components can be assembled in a single genetic element, allowing coordinated expression of membrane protein complexes .

  • Controlled Copy Number: Unlike plasmid-based systems, artificial chromosomes can maintain defined copy numbers, enabling precise control of membrane protein expression levels .

  • Stability Advantages: With proper design elements (such as the HEM1 complementation system demonstrated in yeast), artificial chromosomes can maintain stable expression even without selective pressure .

In the experimental design for such systems, researchers must carefully consider variables such as chromosome stability, expression efficiency, and potential interactions with native cellular machinery .

What are common technical challenges in studying bacterial inner membrane proteins?

Researchers working with bacterial inner membrane proteins like ElyC encounter several technical challenges:

  • Protein Overexpression Toxicity: Membrane protein overexpression often disrupts membrane integrity, leading to toxicity and poor yields.

  • Proper Folding and Insertion: Ensuring correct folding and membrane insertion remains challenging in heterologous expression systems.

  • Functional Assays: Developing reliable assays to verify protein function outside its native membrane environment.

  • Structural Characterization: Obtaining sufficient quantities of stable, properly folded protein for structural studies.

  • Interaction Analysis: Identifying and validating protein-protein interactions within the membrane environment.

When designing experiments, researchers should include appropriate controls and carefully consider how to define and measure dependent variables related to membrane protein function .

How can gene disruption studies be optimized to understand membrane protein function?

To maximize insights from gene disruption studies of membrane proteins:

  • Precise Genetic Manipulation:

    • CRISPR/Cas9-based methods offer improved specificity for gene disruption

    • Clean deletions minimize polar effects on adjacent genes

  • Complementation Controls:

    • Expression of the wild-type gene from an independent locus to confirm phenotype specificity

    • Controlled expression levels to avoid artifacts from overexpression

  • Conditional Depletion Systems:

    • For essential genes, conditional depletion rather than complete deletion

    • Time-course analysis to capture immediate versus adaptive responses

  • Multi-omics Analysis:

    • Combine transcriptomics, proteomics, and metabolomics for comprehensive understanding

    • Integrative data analysis to identify compensatory mechanisms

  • Growth Condition Variations:

    • Test multiple growth conditions to reveal condition-specific phenotypes

    • Challenge mutants with various stressors to amplify subtle phenotypes

Researchers should carefully plan how to assign subjects to experimental groups and consider potential confounding variables in their experimental design .

How do membrane proteins like ElyC coordinate with other cellular processes?

Membrane proteins like ElyC function as integrators of multiple cellular processes:

  • Cell Division Coordination: Proper envelope biogenesis must be coordinated with cell division timing.

  • Stress Response Integration: Membrane proteins often serve as sensors and effectors in response to environmental stresses.

  • Metabolic Pathway Connection: ElyC appears to coordinate with metabolic pathways that produce precursors for cell envelope components.

  • Signaling Pathway Intersection: Membrane proteins frequently function at the intersection of signaling pathways that regulate cellular responses.

Research indicates that disruption of ElyC affects multiple cellular processes, suggesting its role as a coordinator between envelope biogenesis and other essential functions . This integrative role makes membrane proteins particularly important targets for both basic research and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.